SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016185 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016185
Domain Number 1 Region: 107-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000824
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 273-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000304
Family I set domains 0.059
Further Details:      
 
Domain Number 3 Region: 192-259
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000451
Family Pre-dockerin domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016185
Domain Number - Region: 461-517
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0018
Family Carboxypeptidase regulatory domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016185   Gene: ENSTNIG00000013202   Transcript: ENSTNIT00000016396
Sequence length 1009
Comment pep:novel chromosome:TETRAODON8:1:13305444:13311397:1 gene:ENSTNIG00000013202 transcript:ENSTNIT00000016396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIPASSAPGVTEWTSWFNIDHPGGNGDYERLEAIRFYYRERVCARPMAMEVRTTEWVAAA
DTGEVVHSSLEKGFWCINKEQRNGRVCSNYHVRFQCPSGSCPGRIAQSYWTKWSEWGACS
TTVCDDVGIQVRHRKCVNSQPLPLLLVPACQGHHSERRVCSTPPCTAKCQLACPEGRPSE
DCSLCLCEGHILYGEALSVTGAPVAGAWVALASQPKVVLARTDTKGQFRLTGVCSSSSTF
VSINKEKFAPIKVASVSNATGISWVHAVLKSAEKPYMVKHPEDKVRYEGGRVLLCWIKVT
GTVLHLFNYFLRYHNGTLLDKKVYKYEEELVLRDLKPEQSGQYYCKTSSPAGAIKSSPSI
LTVIARGTPACNSTPEAHLIRLPMDCVQPGTDSKYYNAARCPHNQCTGSLDFDMRCRDGA
GFCCGVQQMETRIIDCGSYSLPIRAVTQCSCQKCIQPTVLVRGRVVTADNNEPLRFGHIY
IGKERVGTTGYQGSFTLHISPDTQRLVVNFVDPTQKFLDTTYGMFSVDFRDETNKEMLGA
GAVQVLLDTQHVKMSEHIPKMKLWSLNPDTGVWEEESDFSYPTISDGHGRNKREDRTFLI
GNIEIRERRLFNLDVPENRRCYVKVRAYMSDKFLPAEQLEGVVISLINLEPKPGYSSNPR
AWGRFDSVITGSNGACLPAFCDAQRPDAYTAYVTAMMGGEELEAAPSTPKMNPNIIGVSQ
PYLDKIDYQRSDHDDPALKKTAFKINLAKPNQNNLDETNGPIYPYQNLIACENAPVDANH
FRFFRVEKDRYEYNVVPFQENDLTTWTGDYLSWWPNPQEFRACFIKVKIHGQKEVMIRSR
NLGGTHRETKDKLYGIRDIRSTRDMREANTSAACVEFKCSGMLFDQAEVDRSLISIIPQG
NCRRTDTNSLLVEYLDKHPPAAQNNESHAFTMLAPVDPLGHNYGIYTVTDQNPRAAKEMA
IGRCFDGTSDGSSREMKSDFGVALTFSCPERKISRESLFQRLQTNPGQT
Download sequence
Identical sequences H3D6P4
ENSTNIP00000016185 ENSTNIP00000016185 99883.ENSTNIP00000016185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]