SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016206 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016206
Domain Number 1 Region: 25-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-31
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 2 Region: 189-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-18
Family Laminin G-like module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016206   Gene: ENSTNIG00000013224   Transcript: ENSTNIT00000016418
Sequence length 492
Comment pep:novel chromosome:TETRAODON8:4:899687:902532:1 gene:ENSTNIG00000013224 transcript:ENSTNIT00000016418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATMGSLVAELFLLLLISAAQVHAAGVSFYGDGYIHLRTTEASVQTSLQLRFRTSSQAGLL
FLAVGSRDFLLLELISGHLQVRLDLGSGQLSLRSEKGLHLGDLAWHTVELSHHLHNVTMS
VDGSSLSSLPMPGPDVELSIQSVFVGGTAGLRQAHSLGVSSGFRGCLDRVLFNQHDLTSG
LGPYSGSKSIHEVLPGCSSQFFATEEDAVGFLSSKAFVALQPWEGPQEGAFECEMLPSAT
ADDGVILFTSDKHAGLVAMEIRDGHVVATVVDEKGKKTELRSLTYVHGNKSWHNVQLHLL
ASSVQLKVGQELVRAHLSAQLRFHPRGPLLLGGLDEEARGEASRAGLMSAAGGSFRGCLR
GIRLNGRRTGLPHAAVTKEIGVGCRTSPVLDPQSTTDTTEAPEVELPTTLPHRSKGNMNF
LSLKTLEVAEGGRAPLEPRHIKVNLDFQKLDLHPSQLMFRVEGQPVSGELRLDLSPDSGA
PLAEEQTVVLGA
Download sequence
Identical sequences H3D6R5
99883.ENSTNIP00000016206 ENSTNIP00000016206 ENSTNIP00000016206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]