SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016207 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016207
Domain Number 1 Region: 33-468
Classification Level Classification E-value
Superfamily Ras GEF 3.66e-110
Family Ras GEF 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016207   Gene: ENSTNIG00000013225   Transcript: ENSTNIT00000016419
Sequence length 473
Comment pep:novel chromosome:TETRAODON8:4:880792:883951:-1 gene:ENSTNIG00000013225 transcript:ENSTNIT00000016419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSSGEQPCRSGSVTARGRVYAPAITASYGEMCYHDNSLVSASLEALIQHLVPTVDYYPD
RSYVFTFLLSSRLFLHPYELMTRVCHLCVEQQRSGDALLDKIRLREVAPKLVQLLTEWTE
TFPYDFRDERMMRCLKDMTHLVARGDEFSWRAMQQMSQRLIKRLSALGQYEEAVAALSAV
ALERPAALKSKQASGQRSDILSVCDDAFVLAQQLTHIELDRLSFIGPEEFIQTFAMKDPL
ENHKGFFRKRKTSNLEAYVNWFNRLSYLVATEICLPVKKKHRARMIEFFIDVAQECFNIG
NFNSLMAIITGMNMSPVARLKKTWNKVNTDKFEILEHQMDPSSNFSNYRTALRGATQRSE
TAHSSQEKIVIPFFSLLIKDIYFLNEGCATRLPNGHINFEKLWELAKQVSEFLVWRQVIC
PFERDRRILQYLVTTPVFTEDELHLASYDSEGPENNLEKDSRRSLRSSLLHRE
Download sequence
Identical sequences H3D6R6
99883.ENSTNIP00000016207 ENSTNIP00000016207 ENSTNIP00000016207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]