SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016218 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016218
Domain Number 1 Region: 391-651
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-38
Family YWTD domain 0.0000263
Further Details:      
 
Domain Number 2 Region: 336-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 145-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 224-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 5 Region: 67-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 109-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 26-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 8 Region: 268-298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 190-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 10 Region: 312-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016218   Gene: ENSTNIG00000013235   Transcript: ENSTNIT00000016430
Sequence length 703
Comment pep:novel chromosome:TETRAODON8:4:784618:789727:1 gene:ENSTNIG00000013235 transcript:ENSTNIT00000016430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVTSVMERETVAMGQMKTDVTKGPKCRRGSRMCRDGTQCVLFSHVCDGERDCGDGSDED
GCGSSLCISPGEFQCSHGKMCIPEAQVCDGRPQCWDQSDEIDCRRPTMTCEFHCADGSRC
IPKKFVCDGERDCPDGTDEFGCETVSCFPAEFQCAHGNRCIPRGQVCDGKNDCQDRSDEL
DCQSLPEGCHHLCDNKARCIPETFLCDGERDCADGSDEEKCGLVACESHQYRCASGQCVS
EGLRCDGYPDCSDHSDEEDCARPPRCPAQLRCPNSHECLQREWLCDGEDDCEDGSDEKVK
PRKKRQTWTEVGWCDHHCVSTPEGPRCSCAAGFRLHSNALSCVDVDECNEMPPSLCKHIC
MNTPGSYVCYCYPNFYLEPDDMSCKTKGDEPLLLASVQSELWLLGVHSGSLTLLSSVNRP
VFSLDYHWARQRVYWLSPDYQSIRWADMKKSSSRGTLIKGVKSDSIAVDWIGQNLYWVDG
LVGQILVVKLSDITARSQSYAVALGEDLEQPSSLILLPHLGLMLWSEIGSTPQIERSGMD
GSKREVVVSRDLSWPVSLAYDFLDNRVYWADEKLRCIGSTSLDGDDIKILQLAETPNPFS
VAVFNDRVFWSDTKRRTIRSADKNTGKDQKVLLKRPGQPFGLRVMHELSQPAFSSPCNQL
HCSHLCLLAPALRPKSGTAGDQGTTAVCRCPKGMLLNPDKAAC
Download sequence
Identical sequences H3D6S7
ENSTNIP00000016218 99883.ENSTNIP00000016218 ENSTNIP00000016218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]