SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016371 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016371
Domain Number 1 Region: 180-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000214
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 142-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 3 Region: 102-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000252
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 60-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000384
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016371
Domain Number - Region: 5-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0182
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 33-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0355
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016371   Gene: ENSTNIG00000013380   Transcript: ENSTNIT00000016584
Sequence length 216
Comment pep:novel chromosome:TETRAODON8:17:7908036:7908913:-1 gene:ENSTNIG00000013380 transcript:ENSTNIT00000016584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNHSNSRCDDAGVCRCDPGWEGEQCERCVPMPGCRHGYCQQPWQCNCQAGWGGRFCDKDL
SVCVEKQPCRHGATCVMEDGGDYACVCPEGFYGRNCERRAGPCHQRRPPCKNGGRCEDAD
GFAAELTCRCLAGFTGRRCEADVDDCLMAPCANGATCLDGVNRFSCVCPPGFSGRFCTVN
LDDCVSRPCLNGGRCIDRAGGFRCICQPGFTGTTCQ
Download sequence
Identical sequences H3D780
99883.ENSTNIP00000016371 ENSTNIP00000016371 ENSTNIP00000016371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]