SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016411 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016411
Domain Number 1 Region: 215-407
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-56
Family Eukaryotic proteases 0.00077
Further Details:      
 
Domain Number 2 Region: 133-188
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000565
Family Kringle modules 0.0023
Further Details:      
 
Domain Number 3 Region: 36-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016411
Domain Number - Region: 107-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.0074
Further Details:      
 
Domain Number - Region: 75-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016411   Gene: ENSTNIG00000013417   Transcript: ENSTNIT00000016624
Sequence length 410
Comment pep:novel chromosome:TETRAODON8:17:1531549:1534711:-1 gene:ENSTNIG00000013417 transcript:ENSTNIT00000016624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILDFFFEIVDVATGDDEEDDEGNSDWLYELQEPGGPCNPNPCHNDGVCRQKGRKIKCDC
PKPFKGKKCERGPKYCKRGLCGRGECVLSSVPPFYECRCKEPFQPPDCKTYSVCEPNPCQ
NGGTCVRAGNDFDCQCAPGFRGSLCQVAPNDCYIGDGESYRGTVSETSNGDECLQWNSHF
IIENGVNPFTSFQNKGRYHLRKMSHALNLCCMHLNSEPNKDMQVVIGGLSLDMDEPTEQT
IRVEEVILHENYLETQSAVYNDISLLRLRNNDGVCAVETQFVKSACLPDGQLPDGLECTI
SGWGATEESGFGSNHLLKANVLLINQQKCSEPTVYGNILDVSMLCAGHLQGGVDSCQGDS
GGPLTCSQNATSYVYGLVSWGDQCGKKNKPGVYTRVVQFVNWIKSKIQAP
Download sequence
Identical sequences H3D7C0
ENSTNIP00000016411 99883.ENSTNIP00000016411 ENSTNIP00000016411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]