SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016444 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016444
Domain Number 1 Region: 440-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 2 Region: 393-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000712
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 728-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000082
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 4 Region: 337-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 5 Region: 687-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000565
Family EGF-type module 0.056
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016444
Domain Number - Region: 98-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000646
Family Galactose-binding domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016444   Gene: ENSTNIG00000013449   Transcript: ENSTNIT00000016657
Sequence length 790
Comment pep:novel chromosome:TETRAODON8:4:5363661:5407187:1 gene:ENSTNIG00000013449 transcript:ENSTNIT00000016657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPAGGEVFIKLHCPPALPPPLALLCLLLICHLLVWAAMDSCYDEEGTPSRCMPKFENVAF
NRTVVASNVCGSPPEEYCMQTGSTRSCHQCDAADPERSHNASLLTDFHRNEESTWWQSQS
MYFGIQHPNSVNITLHLGKAFEITYVRLKFYTSRPESFAIYKRTQEDGPWLPYQYYSASC
KKTYGKHMNAYIRPGDEERTALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLGLQE
WVTATDLLISLDRLNTFGDEFFKDPKVLRSYFYAISDFSVGGRCKCNGHASECSEGEQGR
LPCVCQHHTAGDRDVTLFTRQTLGQGHRDSANECLICNCSGRSDQCVFDAEQYRSTGSGG
RCLSCRDNADGPHCERCRENHYRSSIDEPCLPCNCNINGSVSLQCDAEGRCPCRAGVTGE
KCDKCGPGFHSLGPAGCRPCECDPSGSVGDCSPSDGGCHCKANVEGQSCSRCKPGFYNLR
EVNPEGCQACFCFGHSLACSSSSHHVIANITSDFGEDQDGWLGEFFGGKTFPLLWKEGEV
YLLPLTEDDIGFYKAPEKFLGHQAYSYGQLLTITFTSETTELLPNNVTLLLQGSGTTLTA
DLSPQPLFNRDPGLTPQQSFMIRLHEQEERFKPSLSTFDFQYFLYNMTDLQISNAGGRNY
TSQLASVTLTSAAISADLSGPRAPWVESCSCPPGFAGQFCEQCAPGFTRQDPGRGPLSPC
VPCDCHQHGTCHQETGVCECSSFTAGKACERCLEGYYGNALIGTPGDCQPCPCPDQSSCA
RIAPTGQVVC
Download sequence
Identical sequences H3D7F3
ENSTNIP00000016444 99883.ENSTNIP00000016444 ENSTNIP00000016444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]