SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016531 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016531
Domain Number 1 Region: 623-687,886-1228
Classification Level Classification E-value
Superfamily Ras GEF 7.85e-117
Family Ras GEF 0.0000115
Further Details:      
 
Domain Number 2 Region: 222-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.07e-42
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 23-131
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-17
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 
Domain Number 4 Region: 432-588
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000131
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016531   Gene: ENSTNIG00000013535   Transcript: ENSTNIT00000016744
Sequence length 1230
Comment pep:novel chromosome:TETRAODON8:4:3986967:3997312:-1 gene:ENSTNIG00000013535 transcript:ENSTNIT00000016744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGVRYNEGHALYLSVVARKEGTKRGTVSKKTAENGRWADKFFALYQNVLFYFENDQSA
RPSGIYLLEGCTCERAPAPKVSAPSKEPMERQQHYFLILFGHDGQKPLELRTEEEADCNE
WVECIQQASYSDIIIEREILMQKYIHLVQIMETEKVAANQLRTQLEDQETEIERLKAEIV
VLNKTKERLHPCQGNQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRK
RNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSVFLNSETIMFLH
EIFHQGLNARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLL
KQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELS
KMMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSGSERGVLSKVRL
GSLSLRKEGERQCFLFTKHFLICTRTSGGKLHLLKQGGTLSLIECTLIEELDASDEDYNA
AGQGFSHLEFKIVVEPPDAQSFSVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEE
NSKVSVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFL
NTFLHTYRIFTTAAVVIDKLTDIYKKPFTSIPVRSLELFFATSQGAWATDPLNNKSPRLC
RKFSSPPPLSIPSRTSSPVHCRKLSLSSPIGGKAGALDLPQASGVSSITPICTKAPLDLS
RGPSSPELGPAAAEDVSGELPRLDAFCGKLRRSIRRAVLETVSLDKFIPESPVSSEPGDM
SPCRSPSTPRHLRYRQAGVTSGENPRCTMSPASAFAIATAAAGHGSSQGFSNSERTCDKE
FIIRRAATNRVLNVLRHWVSKHSQDFDSNSELKLGVMGLLEEVLRDPDLLPQERKATTNI
LSALSQEEQDDAQLKIEDILQMTENPKAECLESLSAMELAEQITLLDHIVFRSIPYEEFL
GQGWMKVDKIERTPYIMKTSQHFNDMSNLVASQIMAHADVGSRASSIEKWLAVADICRCL
NNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDRLQKTVSSEGRFKNLRETLKNCN
PPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMICHIIREIRQFQQAPYRIEHQPK
VTQFLLDKTLVMDEDTLYELSLKIEPRVPP
Download sequence
Identical sequences H3D7P0
ENSTNIP00000016531 ENSTNIP00000016531 99883.ENSTNIP00000016531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]