SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016574 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016574
Domain Number 1 Region: 172-325
Classification Level Classification E-value
Superfamily E set domains 1.33e-30
Family Arrestin/Vps26-like 0.025
Further Details:      
 
Domain Number 2 Region: 19-186
Classification Level Classification E-value
Superfamily E set domains 5.53e-26
Family Arrestin/Vps26-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016574   Gene: ENSTNIG00000013576   Transcript: ENSTNIT00000016788
Sequence length 418
Comment pep:novel chromosome:TETRAODON8:4:3500880:3506306:1 gene:ENSTNIG00000013576 transcript:ENSTNIT00000016788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVRALAIYFDSLNENNLPVFSGGDMVSGRVVVEVTGDVRVKSLDVHARGVAKVRWT
ESRNAGANTTYTQNYTEEVEYLHHYDTLIGEERDEDCPDENVTVLHTGLHEFAFNFNLPQ
MALATSFEGKHGSVRYWVKAELHRPWLVPVRVKKEFIVFEHIDINMPLLLAPQTGTKEKT
LCCWFCASGPISLSAKIERKGYTPGESIQIFAEVENCSSRVVVPKAALYQTQTFFAKGKG
KQIQQLVSNLRGEPLPQGKSQSWEGKLLKIPPVSPSILDCPIIRVEYALVVYVDVPGGLN
LSVSLPLVIGTIPLNACASRTSSISSNCSTLSWLGLQERPEAPPSYNDLAISEAERRDCL
QGCDRSNVDGGDQGSLLPYITEFRYLPPPLYSEVDPYPGTAEECGAADIRRPDTCPSR
Download sequence
Identical sequences H3D7T3
ENSTNIP00000016574 ENSTNIP00000016574 99883.ENSTNIP00000016574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]