SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016816 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016816
Domain Number 1 Region: 613-668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000419
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 559-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000549
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 668-723
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000127
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 503-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000955
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 758-811
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 444-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000101
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016816   Gene: ENSTNIG00000013814   Transcript: ENSTNIT00000017030
Sequence length 811
Comment pep:novel chromosome:TETRAODON8:5:4411266:4449481:1 gene:ENSTNIG00000013814 transcript:ENSTNIT00000017030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASTMTPLGQQRRLALLLCLVSTAACNLSGFTEEPFERVGKSDGYCSRILRAQSNRKEVNS
EFRLRVEGDPESYQPGSTYRVTLTASSPAYFRGFILIALKEGAEGDRDEDYTGNFQIIDE
EETQYMTNCPPAVAERTPRRRTSNQVYWTAPPGGSGCILLKASIVQKRIIYFQDEGSLTK
RMCEKESLYGDSTDKPLLDCCACGTAKYRVTFYGNWSEKTHPKDYPRRANHWSAIIGASH
SKNYVLWEYGGYASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKMKAQWPAWQPLNVRA
APSAEFSVDRTRHIMSFLTMLGPSPDWNVGLTAEDLCTKECGWVQKVVQDLIPWDAGTDS
GVTYESPNKPTLPQEKIRPLTSLDHPQSPFYDPEGGAITPVARVIVERIARKGEQCNIVP
DNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSATCEKGKRMRQRMLKAQLDLSVP
CPHTQDFEPCMGPGCSDEDASTCMMSEWITWSPCSASCGMGSRSRERYVKQFPDDGSICT
LPTEETEDCVVNEECCSAPSSCLVTEWGEWDVCSATCGLGMKRRERLVKMPPADGSICGA
EVLEVEKCMMPECHTIPCMLTPWSEWSDCSVTCGKGLRTRQRMLKSPVELGDCTEELEQV
EKCMLPECPIDCVMSEWTEWSECNKSCGKGHTIRTRMAMLEPQFGGDPCSETIQRKKCKI
RKCNRGQANSDEKRRRKEQREKRRSKQGRSEVTTQHPGCKMRPWSTWTECTKPCGGGIQE
RLMTVKQKFKTAQLSSCKDRKEIRACNVHPC
Download sequence
Identical sequences H3D8H5
99883.ENSTNIP00000016816 ENSTNIP00000016816 ENSTNIP00000016816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]