SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016866 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016866
Domain Number 1 Region: 26-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-19
Family SPRY domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016866   Gene: ENSTNIG00000013862   Transcript: ENSTNIT00000017080
Sequence length 196
Comment pep:novel chromosome:TETRAODON8:2:11025477:11028879:1 gene:ENSTNIG00000013862 transcript:ENSTNIT00000017080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIFTCCLGCCGDGGSGHIPLKEMPTVQLDTHHMGTDVVIVKSGRRICGTGGCLANAPL
HQNKSYFEFKIQSTGVWGIGVATQKVNLNQVPLGRDTNSLVLRHDGSVYHNNEEKNRLPA
NNLPQEGDIVGVTYDHVEMNLYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCHFSDFYH
TAPQGFEKILFEQQIF
Download sequence
Identical sequences Q4S0Q0
ENSTNIP00000016866 ENSTNIP00000016866 99883.ENSTNIP00000016866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]