SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016891 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016891
Domain Number 1 Region: 67-189
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-32
Family C-type lectin domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016891   Gene: ENSTNIG00000013886   Transcript: ENSTNIT00000017105
Sequence length 190
Comment pep:novel chromosome:TETRAODON8:2:11503078:11504529:1 gene:ENSTNIG00000013886 transcript:ENSTNIT00000017105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILTLLALSLTVALGMSQENEDAPGPMVEDGPPAQVPVEDVAPVLPVPEDPEESQARRG
SHCLGFTHNNRCYRFFKGPRRGDDAEVFCRRLSPEGHLASITSQHLHQEVLHLVQRSNGA
LTRFWVGGSRYLKSSRFIWLDGSPWVYSAWQPGRPRPTSAVENCVEVLVNGRFNDKRCSE
AQAFVCSHPE
Download sequence
Identical sequences Q4S0M2
99883.ENSTNIP00000016891 ENSTNIP00000016891 ENSTNIP00000016891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]