SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016941 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016941
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000025
Family Ovomucoid domain III-like 0.0066
Further Details:      
 
Domain Number 2 Region: 144-221
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000118
Family Calmodulin-like 0.077
Further Details:      
 
Domain Number 3 Region: 227-270
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000575
Family VWC domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016941   Gene: ENSTNIG00000013936   Transcript: ENSTNIT00000017155
Sequence length 306
Comment pep:novel chromosome:TETRAODON8:2:12124397:12128200:-1 gene:ENSTNIG00000013936 transcript:ENSTNIT00000017155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVVEAVCLTNLVLTWAALLHEVQSKSKVCANVFCGAGRECAVSEKGEPSCLCIESCKPH
KRSVCGSNGKTYRNHCELHRDACLTGLKIQVAHDGHCQERKTEQAAASPVVCYAANRNEL
RSRVIQWLQTEVVPGGWLAKGSDLSDILLKYFKKFDNGDSQLDSSEFLKFIQQNESVAEL
QSYADQESNNLLRSLCVDALIELSDENADWKLSFDEFLNCMKPGFNPPEKKCALEDETYE
DGAETQVECNRCVCACGNWVCTAMVCPGEPTDAGAQMTEEEWNLRVAELNKHQETVEKMK
SSTKEA
Download sequence
Identical sequences H3D8V0
99883.ENSTNIP00000016941 ENSTNIP00000016941 ENSTNIP00000016941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]