SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017117 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017117
Domain Number 1 Region: 985-1271
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.61e-93
Family Complement components 0.000000214
Further Details:      
 
Domain Number 2 Region: 1498-1652
Classification Level Classification E-value
Superfamily TIMP-like 1.04e-42
Family Netrin-like domain (NTR/C345C module) 0.0015
Further Details:      
 
Domain Number 3 Region: 1345-1498
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.96e-35
Family Alpha-macroglobulin receptor domain 0.00084
Further Details:      
 
Domain Number 4 Region: 663-735
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 8.76e-22
Family Anaphylotoxins (complement system) 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017117
Domain Number - Region: 815-862
Classification Level Classification E-value
Superfamily E set domains 0.00686
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017117   Gene: ENSTNIG00000014108   Transcript: ENSTNIT00000017333
Sequence length 1654
Comment pep:novel chromosome:TETRAODON8:18:1995221:2005402:-1 gene:ENSTNIG00000014108 transcript:ENSTNIT00000017333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTLLCLLVSVAVATLTSLTHGAPLQVLSAPNLLRVGTTENIFVECQDCTASVKVDINV
MNHPTKSQRLATTSVTLNSGNHFQGLGSIRIPPGDFSKDPNAKQYVYLQAVFPDRILEKV
VLVSFQSGYIFIQTDKTLYTPNSNVLYRIFGLTPRMEPVERDEAAKKDASVSIEFVTPDG
IILPVDPVSLNDGLHSGEYKLGEIVSPGLWKVVAKFQSNPQQSFSAEFEVKEYVLPSFEV
KLEPESSFFYVDSRELVVNIKATYLFGEEVNGNAHVVFGVLKDGQKRSLPNSLQRVPIDA
GKGVVTLKREHITNTFPNIDELEKAYIFVAATVLTEDGGEMVEYELRNIQIVKSPYSIDF
KKTAKYFKPGMSFDVAIEVLNPDGSPAQGVAVVVEPGPVEGLTADNGMARLTVNTVAGNN
KLIISAKTKDRRLSDGRQAKASMTADPYITRGGNYIHIGVDTAELELGDNLKVNLNLNKQ
INQDVTYLILARGQVVDKGRYKIKGQILITLNFPITKDMVPSFRIVAYYHTSDNEMVSDS
VWVDVKDTCMGTLKLESTRPNPSYEPRRMFGLKVTGNPQSKVGLVAVDKGVYVLNNKHRL
TQKKIWDIVEKYDTGCTPGGGKDGMSVFTDAGLLFESNTASGTVYRQELKCKVPSRRKRA
STITEVITTLSSQYQDSVLRECCLDGMKPTTLSYTCERRSEYIGDGKACVQAFLHCCKTM
ESQRAEAQEDNLQLARSEETDNSYMDTDEITSRTQFPESWLWSEITLPSCPKPNCDTSSL
VKNIPLPDSITTWQFTGISLSRTHGICVGESLKVIVRKEFFIDLRLPYSAVRGEQIEIKA
ILHNYSPDLITVRVNLMEEAHVCSSASKRGTFRQEVKVGPQATRSVPFIIIPMKEGEFRV
EVKAAVKDSSLNDGIVKMLRVVPAGVLVKSPQTVTLDPAKKGGKQEEILNSNIPVKDMAP
NTPAKTQISVTGVEQISSLVEKAISGQSMGSLIYQPSGCGEQNMIHMTLPVIATTYLDKT
NQWESVGFQKRPEALQHITTGYKNQLAYRKGDGSFAVWANLKSSTWLTAYVAKVFAMANS
LVAVPDNMICGAVKFLILNAQQPDGLFTEVGTISHGEMIGDVRGADSDVSMTAFCLIAMQ
ESRQLCSATVGSLPDSIAKAVGYLEARLPTVVNPYAAAMASYALANANKFNREFLYKFAS
PGFLSHWPVPKGRVYQLEATAYALLALVKIKAFEDARPIVRWLNKQQKVGGGYGSTQATI
IVYQAVAEYWASAKEPEYDLNVDVLLPGRSGPDKYKLTRENHYTTRTSKINDINQNVTVT
ATGSGEATVTMVSLYYALPKEKESDCTNFNLTVQLFPGKIDEDERVYNLRIDVLYLSKER
DATMSILDIGLPTGFTFNKNDLDLLSKGRARVISKYEANTALSEKGSLIIYLDKISHKHP
EEITFRIHQKLKVGVLQPAAVSVYEYYDRKKTHCVKFYHPERKAGELLRLCRGNECTCAE
ENCSLQKKGKISDHERTAKSCETTPTSKIDFVYKVRVERFTADLSTDVYSMRILEVIKEG
NTDVAPQGKQRPFLSYPHCRESLNLTKGKTYLLMGSSKDIHGGEKGEAFQYVLGERTWVE
YWPTQEECQTEEHTETCLGMQEMQQQYLLFGCQQ
Download sequence
Identical sequences H3D9C6
ENSTNIP00000017117 ENSTNIP00000017117 99883.ENSTNIP00000017117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]