SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017125 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017125
Domain Number 1 Region: 24-184
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-38
Family C-type lectin domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017125   Gene: ENSTNIG00000014116   Transcript: ENSTNIT00000017341
Sequence length 185
Comment pep:novel chromosome:TETRAODON8:18:1799882:1801462:1 gene:ENSTNIG00000014116 transcript:ENSTNIT00000017341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRNLQRVVAVSFGLLCVLQALLNVSLRLILYNQAANQGNCCNSTTEERSILHKLDPYF
QDGWILFQTSLYYISPEENTWGLSRDFCLQKDADLTVINSKAEQNFAGKFKRAVWIGLME
PENDSRFRWVDGTPLTESYWIQGEPNNYHGIEEDCVELVSEVGREGWNDLNCSSKNFFLC
EKKII
Download sequence
Identical sequences Q4RZS6
99883.ENSTNIP00000017125 ENSTNIP00000017125 ENSTNIP00000017125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]