SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017159 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017159
Domain Number 1 Region: 158-242
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.37e-23
Family Thyroglobulin type-1 domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 21-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.12e-22
Family Growth factor receptor domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017159   Gene: ENSTNIG00000014149   Transcript: ENSTNIT00000017375
Sequence length 249
Comment pep:novel chromosome:TETRAODON8:18:1397305:1405064:-1 gene:ENSTNIG00000014149 transcript:ENSTNIT00000017375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CWGFWAFSALSLAALCLSDQAIRCPVCSEERLARCRLPEGCEETVREPGCGCCPTCALAK
GAHCGVYSPRCGTGLRCYPPRGVERPLHSLMHGQGVCTDEREVEENSATDRQDEIIPEHP
NNSNIRCSQQDKRCIQKTLARHLSKSTNQRSNSGREETKAVLAPCRAELQRALDRLASNT
RTHDDLFTIPIPNCDKNGDFHIKQCHPARDGQRGKCWCVDQKTGMRLPGPLEPRGDLDCH
QLTSPALRD
Download sequence
Identical sequences H3D9G8
99883.ENSTNIP00000017159 ENSTNIP00000017159 ENSTNIP00000017159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]