SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017243 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017243
Domain Number 1 Region: 124-192
Classification Level Classification E-value
Superfamily Class II MHC-associated invariant chain ectoplasmic trimerization domain 1.23e-25
Family Class II MHC-associated invariant chain ectoplasmic trimerization domain 0.0013
Further Details:      
 
Domain Number 2 Region: 169-256
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-22
Family Thyroglobulin type-1 domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017243   Gene: ENSTNIG00000014229   Transcript: ENSTNIT00000017460
Sequence length 280
Comment pep:novel chromosome:TETRAODON8:1:524609:527222:-1 gene:ENSTNIG00000014229 transcript:ENSTNIT00000017460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGQEDAPLARGSVAGSEEGLILRARPAGGSNSHALKVAGLTTLVCLLLGSQVFTAYMV
FGQRQQIRELQGNNKRISNQLTRSSQAVAPVRMQVPMRSLPMMRAFDPDTDTPIMPKAAV
QETVVSVETQVKDLLQNFTLPAFNSTFASNLLALKSQMDQTTWQKLESWMQSWLIFQMAQ
EKPPTITATPAPVMTKCQKEAASVKHLLGTRKPQCDELGQYTPIQCWPAVGMCWCVDSSG
TAVPGTAVRGHPNCPRAAASPRHMMLAPLREMAAVDVEGE
Download sequence
Identical sequences H3D9Q2
ENSTNIP00000017243 99883.ENSTNIP00000017243 ENSTNIP00000017243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]