SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017255 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017255
Domain Number 1 Region: 48-172
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 25-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000122
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 3-22
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000521
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017255   Gene: ENSTNIG00000014241   Transcript: ENSTNIT00000017473
Sequence length 172
Comment pep:novel chromosome:TETRAODON8:Un_random:94312503:94313242:1 gene:ENSTNIG00000014241 transcript:ENSTNIT00000017473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLENDYSCTCPQGFYGKNCEIIAMTCADGPCFNGGTCVETTTGGYTCRCPPSYTGSNCEK
KLDRCSNRPCLNGGQCLDLGQSVLCRCQPGYAGANCQVNVDDCATAPCQNAGTCQDGVND
YTCSCTLGYTGKNCSVRSDACGERPCQNGGTCFTHFTGPVCQCPKGFMGPSC
Download sequence
Identical sequences H3D9R4
ENSTNIP00000017255 99883.ENSTNIP00000017255 ENSTNIP00000017255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]