SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017281 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017281
Domain Number 1 Region: 307-435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 147-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000258
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 214-323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000471
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 442-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 490-529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000683
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017281   Gene: ENSTNIG00000014267   Transcript: ENSTNIT00000017499
Sequence length 579
Comment pep:novel chromosome:TETRAODON8:13:9089857:9099444:1 gene:ENSTNIG00000014267 transcript:ENSTNIT00000017499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISIEDCCKDGQKRAKTFEDCSSIPLIFDSITCMAVQEQCCLAVLQDNMCATGINMAKTKG
SCDDLFANTCVNKTTKMCCDCCLLGKEARERSLPCDPSLPVGHRCSQVFRVCCADEAQVN
QTTPTQQTKFPAQDKTDKNGDNSVLADKCDVFPGTCAHRCVDNNTCACFDGYKLKPDKKS
CEDINECLLGAGNCRGGERCINTEGSFRCQREVSCGTGYELTDNNNCKDIDECGTGIHNC
GQEFKCQNTQGSFRCLPKVNCEMGFIQDALGNCIDINECVSQTSPCHRGQFCVNTHGSYT
CQTTVNCGRGYHLNEEGTRCVDIDECKSVDVCSGHACINVLGSYRCECQAGYIFNSITRV
CEDINECRHYPGRLCAHKCENTPGSYKCSCTTGFKLASDGRNCDDLNECENNPCSQECAN
VFGSYQCYCRRGYQLSDIDGITCEDIDECALPTGGHICSYRCHNTPGSFHCSCPINGYTL
ATNGRSCQADVDECLTGTHTCAENQSCFNIQGGFRCLSFECPNNYRRVGETLQRIQLSDT
VRCIKSCKPNDMACVLDPTHSISHTFISLPTFREFLKPE
Download sequence
Identical sequences H3D9U0
ENSTNIP00000017281 ENSTNIP00000017281 99883.ENSTNIP00000017281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]