SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017389 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017389
Domain Number 1 Region: 108-318
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.3e-52
Family Reprolysin-like 0.00072
Further Details:      
 
Domain Number 2 Region: 411-468
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 722-778
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000968
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 777-817
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017389   Gene: ENSTNIG00000014372   Transcript: ENSTNIT00000017607
Sequence length 836
Comment pep:novel chromosome:TETRAODON8:16:8173341:8177727:-1 gene:ENSTNIG00000014372 transcript:ENSTNIT00000017607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAFGRNMTLNLVPDTSFLAPTFSVQRIRASGAAAAPNRSSELGEQLRACFYSGTVDAEA
DSLVAVSLCSGISGSFTTGGTEYLIRPQPHVLSRRTGPGSLRFRRFVSAPRFIETLVVAD
ASMAYFYGDEIQHYVLTLVSTAAQLYRHPSIKNRVSLVLVKMLVVEDAEAGPRLSANGGV
ALRNFCSWQQLFNPPSQRHPEHYDTAVLFTREDICGQKSCDTLGVADVGTMCDPKRSCSV
IEDNGLQDAFTAAHELGHVLSMPHDDSKTCEGLFGPLGGHHLMAPVLLSLDRTAPWSPCS
ALHITEFLDNGHGDCLLDVPHSAVALPAGLPGAAYSLDQQCQQVFGEEFLHCPNASDGAA
CSQLWCREDGTLQCSTRNGSLPWADGTPCGPDGTCLHGACTPTQEVMRPPVVVDGGWGAW
GAWRRCSRTCGGGVEFSHRECTDPEPQNGGKYCEGQRVQYRSCNTQACPGHSAKSFREEQ
CERYNSPAYLDHNGHVKEWIPKYAGVSPRDRCKLFCRARGSSEFKVFESKVIDGTACGPD
TTSVCVQGQCAKAGCDRVIGSSLRLDKCGECGGSGLSCRKITGLYNKVTYGYSDIVTIPA
GATNIDVKQRSHGGLKHDGNYLAVKSQSGGYILNGNYSVTTVEQDIPLPGAVLRYSGSST
TLERVQSFRQLREAVTVQLLSTAGDAVPAKVKYTFFIPRDAAFGRSGERTASSPSLYAVR
PVGVADWALGEWSACSKSCGSGWSRRTVECQDAAGFSSARCDPGLKPADLRACGDLPCPV
WQAGPWSACSPACGTGERRRGVLCVDYTGMPVEPDKCDPQKKPWPVSAQCHGNECL
Download sequence
Identical sequences H3DA48
99883.ENSTNIP00000017389 ENSTNIP00000017389 ENSTNIP00000017389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]