SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017390 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017390
Domain Number 1 Region: 82-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-50
Family Reprolysin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000103
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017390   Gene: ENSTNIG00000014373   Transcript: ENSTNIT00000017608
Sequence length 665
Comment pep:novel chromosome:TETRAODON8:16:8179107:8182049:1 gene:ENSTNIG00000014373 transcript:ENSTNIT00000017608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCFYSGDVNADPDSFAALSLCGGLSGGFSLDGAEYSISPGGPPGGRGDPVERTHVISRRR
VANSTGWVVRGPPRRARRFSSVPRFLEALVVADASMAAAHGDDLEHYLLTLMAVVARLYR
HPSLRNPVSVVVVGVVVTGEAPRGPRVSGNAALTLRDFCSWQRKLNRQSDRHPDHWDTAM
LFTQQDLCGATTCDTLGMADVGTVCDPQRSCSVVEDDGLPTAFTAAHELGHVFNMPHDNV
KACRDVFGTLQDHMMSPTLVQVDGGRPWSACSAAILTDFLDRGHGDCLLDRPQKHLSLPA
GPPGSAYNLQRQCRLAFGPASRPCPFTPPCSKLWCTGSARGQAVCQTRHFPWADGTGCGG
GRVCYRGTCIAKNSTSRPKVQVNGRWGPWGPYGGCSRSCGGGVQLARRECDNPAPENGGK
YCHGLRLKYRSCSLRPCPDTGKSFRKQQCEEFNGLKLNTTRLGSSVTWVPKYSGVAPEDQ
CKLICRANGTGYFYVLAPKVVDGTPCSPDTPSLCIQGRCIKAGCDGRLNSRKKFDKCGVC
GGNNQGCKKVSGRFAKPIRGYNFVVTLPVGAANVDIRQRGYRGMSSDENYLAVKDCRGHY
LLNGGYVVSAAERDLLVRGGLMRYSGTSPAVETLRAVAPLQEPLTVELLSVGGMTPPRVR
YTFYV
Download sequence
Identical sequences H3DA49
ENSTNIP00000017390 ENSTNIP00000017390 99883.ENSTNIP00000017390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]