SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017563 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017563
Domain Number 1 Region: 202-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-54
Family Reprolysin-like 0.00077
Further Details:      
 
Domain Number 2 Region: 505-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 808-863
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000102
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017563   Gene: ENSTNIG00000014539   Transcript: ENSTNIT00000017783
Sequence length 863
Comment pep:novel chromosome:TETRAODON8:3:5980157:5989713:1 gene:ENSTNIG00000014539 transcript:ENSTNIT00000017783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPARRTDGVVRTIDRIYHGGGKVGYLLYLDGSRFQLDMERDESALSHHFGSRDVFALMG
DSPAPPPRECVYRGTVDSNPESLAVLTLCGGGLQGFFAVNRSRYTITPIVRAKGHERDVR
TLQDKDAERALHAFTRERFSFEATREGRESCGTRDGRGGRRLRRHRRGGRDREGLAGENG
PHGTRGRRRRGRLEQRRKRSVSRARHVELLLVADETMTKKYGKDLNHYLLTLASIASRLY
GHASIENPIRLSVVKVTAVSDGEKGLDVSKNAAATLKSFCKWQNQQNPLDDDHQHHHDAA
ILFTRQDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDD
SKFCEERFGVNSDKRLMSSILTSIDASKPWSRCTSATITDFFDDGNAECLLDSPRQPLLG
PEELPGQSYDAVRQCRLAFGPEYTVCPGMDVCSRLWCAVIRQGQMVCLTKKLPAVEGTPC
GKGRICLQGKCVDKTRKRHYSVSNHGSWSSWGPWGSCSRTCGGGLQFAQRLCNNPPPRNN
GRYCTGKRAIYRSCNVTPCPPSVKSFREEQCEVRNGPQTDPKGVKTFVEWVPKYAGVLPK
DVCKLTCRAKGTGYYVVFSQRVTDGTECRPYSSSVCVKGKCVRTGCDGIIGSKLQYDKCG
VCGGDSTGCIRVVGNFTKKSKGYTDVVKIPAGSTHLKVRQHKAKDQTRYSAYLALRRPNG
DYLLNGKFMISTSETIIPLIGSVLNYSGWSQRDEWLHSMGPGALQEALVVQILATDAKKP
LDIRYSFFMPRRTGAQQPSGPVLPTSAPGPGWVTGSWMTCSRTCDTGWQSRTVQCKNLDG
KLSKGCVLSSRPSAFRPCLVKKC
Download sequence
Identical sequences H3DAM2
ENSTNIP00000017563 99883.ENSTNIP00000017563 ENSTNIP00000017563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]