SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017575 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017575
Domain Number 1 Region: 498-677
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-49
Family SPRY domain 0.00073
Further Details:      
 
Domain Number 2 Region: 185-250
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.94e-17
Family B-box zinc-binding domain 0.0000356
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000353
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 4 Region: 396-503
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000228
Family Fibronectin type III 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017575
Domain Number - Region: 128-182
Classification Level Classification E-value
Superfamily RING/U-box 0.000388
Family ZZ domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017575   Gene: ENSTNIG00000014550   Transcript: ENSTNIT00000017796
Sequence length 684
Comment pep:novel chromosome:TETRAODON8:3:5326113:5340625:-1 gene:ENSTNIG00000014550 transcript:ENSTNIT00000017796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLESELTCPICLELFEDPLLLPCAHSLCFGCAHRILISHCATNESVQSIGAFQCPTCR
YVISLSPERGLEGLKRNVTLQNIIDRVQRASSSAGLPLPLPLPHSGPNSPGEEGSNRLAL
VPVNAAMSSPGTPPEPVQCQFCEQDPPQDAVKTCVTCEVSYCEECLRATHPNKKPFTGHR
LIEPMPDSHLRGLQCLEHEEEKVNMYCVTDDQLICSLCKLVGRHRDHQVAALSDRYEKLK
QALDSNLSNLIKRNNELESLMGKLIQTCQHVEVACSYWFGHLLKFCFDILRRLMCHFVLL
LTRKKSLYLLKLLSFFVSLSHCFFCYAHILCILVTTTHKIEINVRKHESELQCNFNNRVS
MATASTQVLIPEIHLTDTFDTFALDFGREKKLLELDYLTAPNAPCIREELCTASYDTIAV
HWTSDDEFTVVSYELQYAIFTGQSNIASLCNSLDSWMIVPNIKQNHYTVHGLQSGTKYIF
VVKAINQAGSRSSEPATLKTNSQPFKLDPKSAHKKLKVSHDNLTVERDETTSKKGHSQER
FSSQSSYGVVGNVYIDSGRHYWEALIGGSTWYAVGIAYKSCPKHEWIGKNSASWVLCRCN
NSWAVRHNSKEFTIEPLPHLRRVGVLLDYDAGCVTFYDAVGSQHLHTFHVSFAQPICPVF
NVWNKCLTILTGLPIPDHLEGLDP
Download sequence
Identical sequences H3DAN3
ENSTNIP00000017575 ENSTNIP00000017575 99883.ENSTNIP00000017575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]