SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017680 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017680
Domain Number 1 Region: 1200-1427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-40
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 107-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-31
Family Cadherin 0.00064
Further Details:      
 
Domain Number 3 Region: 221-333
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-30
Family Cadherin 0.0006
Further Details:      
 
Domain Number 4 Region: 637-749
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 5 Region: 326-431
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-28
Family Cadherin 0.00054
Further Details:      
 
Domain Number 6 Region: 1442-1651
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-26
Family Laminin G-like module 0.0061
Further Details:      
 
Domain Number 7 Region: 528-632
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 8 Region: 737-857
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 431-532
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-23
Family Cadherin 0.0008
Further Details:      
 
Domain Number 10 Region: 9-111
Classification Level Classification E-value
Superfamily Cadherin-like 4e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 11 Region: 845-951
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000899
Family Cadherin 0.012
Further Details:      
 
Domain Number 12 Region: 1140-1178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 1774-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000406
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1644-1678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000443
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 15 Region: 1684-1719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.027
Further Details:      
 
Domain Number 16 Region: 2269-2484
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000022
Family Rhodopsin-like 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017680
Domain Number - Region: 1120-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00613
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017680   Gene: ENSTNIG00000014652   Transcript: ENSTNIT00000017903
Sequence length 2743
Comment pep:novel chromosome:TETRAODON8:11:6687045:6716431:1 gene:ENSTNIG00000014652 transcript:ENSTNIT00000017903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRRSINSSPQFQPPMYQVSVAENKPAGTAVALKAVDADEGEAGRLEYFIEALFDSRSNS
LFAVDPANGAVSTVEVLDRETKDTHVFRVTAVDHGAPRRTAMATLTITVSDTNDHNPVFE
QQDYKENIRENLEIGYEVLTVRATDGDAPVNGNILYRIINGNGSNDVFEIDSRSGVIRTR
GLVDREQVEAYMLLVEANDQGRDPGPRSATATVHIVVEDDNDNAPQFSEKRYVVQVPEDM
APNTEILQVTATDEDRGSNAVVHFSIMSGNTRGQFYIDAQTGKMDLVSHLDYEANKEYTL
RIRAQDGGRPPLSNISGLVTVQVLDVNDNAPIFVSTPFQATVLENVPLGYSIIHIQAVDA
DSGDNSRLEYRLTSTTPNFPFAINNSTGWIVVAAELDRESVDFYNFGVEARDQGYPVMSS
SASISMTVLDVNDNNPEFTQKAYYMRLNEDAAVGTSVLTVSAVDQDINSVVTYQISSGNT
RNRFSITSQSGGGLITLALPLDYKLERQYVLTITASDGTLFDTAKVFVNVTDANTHRPVF
QSSHYTVNINEDRPMGTTVVLISATDEDTGENARITYFMDDSIPQFDIDPDSGAVTTQME
LDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNGPRFLRDHYVGSVMEDVPVFT
SVVQVSATDRDSGLNGRVFYTFQGGEDGDGDFIIESTSGIVRTLRRLDRENVPVYNLQAF
AVDKGVPALKTPVNIHVTILDVNDNPPVFEKDELDIMVEENSPIGLVVGHVSATDPDEGS
NAQIMYQIVEGNIPEVFQLDIFSGELTSLIDLDYETRNEYVIVVQATSAPLVSRATVHIK
LVDKNDNVPVLKNFQIIFNNYVTNKYSSFPSGVIGRIPAHDPDVSDQLHYSFEVGNELNL
VLLNQSTGEIQLSQALDNNRPLEASMRISVSASADGVHAVSAQCLLQVTIITDEMLSNSI
TLRLANTSQEQFLSLLLAQFLDGVARVLSASRQDVVIFNIQDDTDVSARILNVSLSVAVP
VFAQARQQPRGLGRGATDRPGAGAESAGGDFFGSEELQERLYLNRSLLAKISSQEVLPFD
DNICLREPCENYMKCVSVLKFDSLRAVSSTSDTMFRPIHPIAGLRCRCPTGFTGDYCETE
IDLCYSKPCGAHGVCRSREGGYTCECLEDYTGEHCQLSSRSGRCAPGVCRNGGTCVNLLV
GGFKCECPSGGYEKPYCEMTTRNFPPHSFLTFKGLRQRFHFTLSLTFATREPNGLLLYNG
RFNEKHDFIAMEIIDEQIQLTYSAGETKTTVAPRIPGGVSDGQWHVVEVHYYNKPILNQA
GLPQGPSDQKVVVVTVDNCDTSVALRFGHVIGNYTCSARGSQSGSKKSLDLTGPLLLGGV
PKLPEDFPVRNRQFMGCIRNLRVDNQHVDMASFIANNGTLPGCSAKRHFCNTNPCLNGGT
CVNLWGSFSCDCPLGFGGKSCERVMASPQRFLGNSLLQWNNMAAVASSVPWHVELMLRTR
QASAILLHISSGLQHNLTLQLRDGSVLMGLHQGENSTLSRLEEVLVNDGEWHHLQLDISS
LGRPLSHHKAVLSLDQGLYLASMEVDGKLRESKLKTVSVGGLAAPGGKILQGFRGCIQGL
RIGGALSLSQARKVNVEPGCSVPDPCSSNPCPANSYCRDDWDSHSCTCLTGFYGNNCTDA
CSLNPCEHESVCTRRLSSSRGYTCDCSRNYFGHYCEKNRTDLPCPRGQWGHKTCGPCNCQ
TDKGFDFDCNKTSGECRCKDNHYRPEGSGGCLLCDCYPLGSFSRACDRDSGQCQCKPGVI
GRQCDRCDNPFAEVSANGCEVIYDSCPQAIEAGIWWPRTKFGLPAAVSCPRGTLGTAIRH
CDEHKGWLPPSLFNCTSSTFSRLQTLAEKFSHNASLLDAGHVRQTAAMLANATLHTETFY
GSDVKVVYRLVRSLLQHESHQQGFNLTATQDVHFTENLVRVSSAVLSPDTRPHWELIQHS
EGGTAALLRCFEEYTNTLAQNMRKTYLSPFTIVTPHIVISVDRLKKLGFAGARLPRFQAL
RGPRPADLETTVTLPDSVFQPPVDTKGHRHLDVFPEPSSRNRSTVRKRRHPEDEQQDAVA
SVMIFYSLASLLPESYDSDKRSLRVPKRPVINTPVVSIAVHDNDKLLQHNLDKPISVQFR
LVATEERSKPICVLWNHTILSGGRGGWSAKGCEVVFRNSSHISCQCYHMTSFAVLMDVSR
RENGEILPIKVLTWSTVGVTLGFLLLTTVFLLCLRAMKCNKTSIINNGATALFLSELIFI
LGINQADNPFLCTIVAILLHFFYLCTFSWLFLEGLHIYRMISEVRDINYGPMRFYYLIGW
GVPAFITGLAVGLDPEGYGNPDFCWLSVHDTLIWSLAGPVAVAVSVNVLLYALSSRASCS
PHHHSLEKKEPRVSGLKTAGGVLLLVSLTCFLALLSVNSDVILFHYLFAGFNCLQGPFVF
FFRVVFNKEARSAMKYCCGRRRPDHMTKPKAAGSKCRRTCAEGQLYHLPFGGSSASLNGT
LRSGKSQQSYLPFLLRDEALSSSQAHIALNDHASLFHQTEEQPDESDSDSDLSLEDDQSG
SYASTHSSDSEDEEGPLPPEECWENLAANADSRMLRPAGEESEDGEAAAPDGPRPDVPNH
PDSGLGPNASAFPDSRTQDSLTGVPSHSAPPHRGILKKKQLSPIAERNCPSRPADAPASP
RGSSSSGGRAKAEQLNGVALTIKAGTVDGDSSGSEFLFFNFIP
Download sequence
Identical sequences H3DAY8
ENSTNIP00000017680 ENSTNIP00000017680 99883.ENSTNIP00000017680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]