SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017848 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017848
Domain Number 1 Region: 30-212
Classification Level Classification E-value
Superfamily TIMP-like 7.85e-65
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017848   Gene: ENSTNIG00000014809   Transcript: ENSTNIT00000018072
Sequence length 224
Comment pep:novel chromosome:TETRAODON8:11:4666166:4670466:-1 gene:ENSTNIG00000014809 transcript:ENSTNIT00000018072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEERSVSLGLWVLLLLSAGMEEVVEGCSCLPAHPQQLFCSSEIVIRAKISGEKIVSP
GNNSSPYMKMIQYEIKMIKMFKGFDKAKDIQYVYTPVFSSLCGVKLDYNNKAGYLLSGSM
WRDGRISVGQCDLVESWDNLSLSQKKNLNYRYQIGCECRINTCYTVPCVSAGENECLWTD
WLLDNSLNGEQARQYACIRRSDTTCSWYRGGPPPEKDFLDMTDP
Download sequence
Identical sequences H3DBF6
ENSTNIP00000017848 99883.ENSTNIP00000017848 ENSTNIP00000017848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]