SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017939 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017939
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.72e-62
Family G proteins 0.0000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017939   Gene: ENSTNIG00000014895   Transcript: ENSTNIT00000018163
Sequence length 206
Comment pep:novel chromosome:TETRAODON8:15_random:2661465:2663484:-1 gene:ENSTNIG00000014895 transcript:ENSTNIT00000018163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMVLG
NKCDINDKRQVSKDRGEKLALDYGIKFMETSAKANINVENAFLTLARDIKSKMEHKIEGN
APQGGTHGVKISEPQKKSSFFRCSLL
Download sequence
Identical sequences H3DBP6
ENSTNIP00000017939 ENSTNIP00000017939 99883.ENSTNIP00000017939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]