SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018025 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018025
Domain Number 1 Region: 362-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 2 Region: 284-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number 3 Region: 226-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 4 Region: 91-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 5 Region: 447-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 6 Region: 51-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 7 Region: 189-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 410-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018025
Domain Number - Region: 138-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00044
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number - Region: 323-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018025   Gene: ENSTNIG00000014976   Transcript: ENSTNIT00000018249
Sequence length 492
Comment pep:novel chromosome:TETRAODON8:2:9987193:10005518:-1 gene:ENSTNIG00000014976 transcript:ENSTNIT00000018249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSGINMHAVVLVQSVLALLLLILLSAVEDTLLQSVSQVGGVCRLSTESSLHRCRTPDGKI
CSGRGKCECGICFCTATDPGKFYGPRCECQDWVCATFNGKTCNDRGYCDCGTCECDEGWS
GDACHVQEECNLSKKKSKELCRNPQGVVCSNRGSCNCGSCMCDDGDNRGLVTGVFCECDD
NECLDEETGEVCGGHGQCYCGNCYCAAGWHGDKCEFQCDISPWESKRRCTSPDGKICSNR
GTCVCGECNCYDVDPSGDWGDIHGDTCECDERNCHATYDRYTDDFCSGHGQCNCGKCSCK
EGWTGKKCEHPLSCLMSLESSMKKCHGTSNLPCFGRGQCLCGQCTCHPSGDTRIHGKNCE
CDDRQCENMSGEVCGGHGYCSCGRCICQDGWFGKLCQFPRSCDMSDAHSKELCETSDGDF
CSGKGSCHCGQCICNPQDWWVSGEYCECDDRECDKHDGLVCTEGNGFCNCGTCECWDGWT
GNACEIWVGAEY
Download sequence
Identical sequences H3DBY2
ENSTNIP00000018025 99883.ENSTNIP00000018025 ENSTNIP00000018025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]