SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018233 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018233
Domain Number 1 Region: 26-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-31
Family Spermadhesin, CUB domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 185-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-29
Family Spermadhesin, CUB domain 0.0000136
Further Details:      
 
Domain Number 3 Region: 137-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000172
Family EGF-type module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018233   Gene: ENSTNIG00000015177   Transcript: ENSTNIT00000018458
Sequence length 297
Comment pep:novel chromosome:TETRAODON8:9:2218820:2222436:1 gene:ENSTNIG00000015177 transcript:ENSTNIT00000018458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRFGPSGCCVLVLISLLSVTLSEDLAGLYGSFTSPNFPQPYADDQHVVWNVSVPEGHRIR
LYFGHFSLEPSNQCEYDYVQVLAEGNETVRFCGEEEKSSESAPGSTVILTAGNLMSVVFR
SDYSNEGRFTGFQAFYSAEDINECLSEIDGERACDHLCHNYIGGYYCTCRRGYLLHQDRR
SCTVPCSGRVLTSPSGVLTSPDHPGPYPPMSQCNYTIRLPEGYRITLAFLEPFDVEGHPE
APCPYDALKVSVPGQEFGPFCGSEPPARIDTGSFRVSVVFTSDASGRNRGWKIQYNS
Download sequence
Identical sequences H3DCJ0
ENSTNIP00000018233 ENSTNIP00000018233 99883.ENSTNIP00000018233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]