SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018283 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018283
Domain Number 1 Region: 3275-3450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-29
Family Laminin G-like module 0.00095
Further Details:      
 
Domain Number 2 Region: 3105-3260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-23
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 3 Region: 2898-3035
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-17
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 2516-2717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000218
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 5 Region: 2726-2899
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000435
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 6 Region: 1471-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1381-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 714-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 9 Region: 1803-1845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 10 Region: 343-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 11 Region: 1520-1568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 767-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 616-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1864-1908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 15 Region: 526-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 16 Region: 669-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 17 Region: 254-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 18 Region: 1970-2255
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000589
Family Tropomyosin 0.00081
Further Details:      
 
Domain Number 19 Region: 1764-1805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 20 Region: 571-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018283
Domain Number - Region: 384-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 1433-1469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family Laminin-type module 0.039
Further Details:      
 
Domain Number - Region: 57-142
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0111
Family APC10-like 0.037
Further Details:      
 
Domain Number - Region: 2275-2352
Classification Level Classification E-value
Superfamily Colicin 0.0277
Family Colicin 0.0049
Further Details:      
 
Domain Number - Region: 2275-2479
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0868
Family BAR domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018283   Gene: ENSTNIG00000015225   Transcript: ENSTNIT00000018508
Sequence length 3451
Comment pep:novel chromosome:TETRAODON8:15:6608274:6641406:1 gene:ENSTNIG00000015225 transcript:ENSTNIT00000018508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYNLNPPYFNLAEGSRISATATCGEDESGRPRYDLYCKLVGGPTIGVPTENIQGQYCSFC
NSNDPNNAHPVSNAIDGTERWWQSPPLSRGLVHNEVNVTLDLGQLFHVAYILIKFANSPR
PDLWVLERSVDHGRTFTPWQYFAHSRRECIEQFGKQPNARILHDDDQLCTTEYSRIVPLE
NGEIVVSLVNGRPGAQRFTYSPVLQDFTKATNIRLNFLRTNTLLGHLISKAQRDPTVTRR
YYYSIKDISVGGRCVCHGHAQVCGGGSNQDRTNRLHCMCQHNTCGESCDRCCPGFNQKPW
RSATVDSPNECQPCQCFSHASDCFYDPEVEKNRASLDTFGRYDGGGVCINCQHNTAGVNC
ERCIEGFYRPFGVPPESPSGCIPCRCDERTTAGCEMGSGRCICKPQFSGENCDRCADGYV
YYPQCIRKLCLVAGIYFWCLLLVCLWALAGMVKSERRNLCINLTGISLISLSVGSMQPVP
SQTLTVIDWISCIPNIHQIPRRTDCCHAGPSACPPGYFGSPSCRQCVCDYRGTVREVCDA
LGRCLCRQGVNGERCDRCQPGYHHFPNCQGCICDGAGVANSICSPDGQCVCLTNYRGQNC
DDCAPGYYGYPDCATCQCSTEGSYGNICNSVSGQCLCLPGVVGQQCDQCASGLRFPQCSG
SISRCNSAGTEIFDPQTFQGSCRCLENVEGTLCDRCKPLYWNLAVVNPQGCKECQCDVKG
TLSGVGDCQQKSGQCHCKPYVSGLSCDTCKDGYFQLQKKKYFGCQDCQCDLGGAVDMSCD
GTSGQCRCRDHVVGRQCREPAPNFYFPTLHQLKFEIEDGVTPNSRAVRFGFNQREFPGFS
WRGYAVMSPAQPEVILTLPLGFPGPFHIVIRYSTPRQKGDVRVRARILLVDEAAFQSCCN
WSDQSKEVIFPESPSPTFLTVPGEGFAEPFELTPGKWIIYLRAEGILLDYLVLLPQDYYE
APMLREKITQPCTYLPTASRDGFSCLLYKHVPLDGFSSSLGSHGTLSSRNKRRRRRQAHV
RRPTPDHPEMAVLSGRQSNLQLNLRVAHPGPYVLILEYASEVDAVQNLNMLISEQSGDYV
PARANIYSCTYSFFCRSVALDGSNRASVLQLSHKTEVLMQTSTTLLLLYKVYAIPAEEFS
LDYVDPKVLCVSTHGRFTEDSRHCIQSQFDKPASARVLYASRDGRLSSGTSASLQRQENV
DWRRRRQTVVPVPQSDGVLLKFPQTEITLTPQEPLRGRYVPLVHYHQPEHASFPVDVRVS
AGREWKGSMNATFCPAVSGCRKAVFSDGEVALDFDGNSWQQPVVSVTVPPNKTLVLDYIL
LVPDSTSTPNLLNEKLIDRSADFIQKCRGEGFHIDPKTASQFCRESARALAAAYNDGALP
CNCDRSGSTGSTCDPAGGQCTCRQHVIGRQCTKCATGYYGFPYCRPCECGRRLCDEVTGK
CICPPQTVKPSCEVCQAQTFSYHPLLGCDGCECSPTGIRDVTRPDCDRLTGQCSCKPRIG
GRQCDRCAPGYYRFPECIPCNCNRDGVTPEVCHPDTGRCLCKKNVAGVECDACKDGSFYF
DPSNPHGCTSCFCFGATNRCQSSSKRRGKFVDMAGWRLESLDQEVVASVLNPASDTVVAD
VQELSPTVQTLHWVAPSSYLGNKVSSYGGFLTYQSKSFGIPSEGMTLMDRRPDVVLTGQG
MTLIHMAPQVPLPDRLYQGRVQLLEGNWRHGINNKPVSREELMMVLADLAGLRIHALYFT
QTQRLGLGEVGLEETSLGGTGGPGNTVEQCSCPPQYTGDSCERCSPGYYRDDSAPFPSRC
VPCECNGHAEECEDKTGRCLNCRYNTAGDRCERCKEGYYGYATRGTCRVCPCPFSVPTNS
FAVGCREVFGDFQCVCREGYTGNKCQSCAPGYYGDPLVAGGRCQACRCSGNGNSCDSRTG
VCKNTLEPGDTDTDGQCQGEPTKNRTSSVEIARPVPECDNCAQTLLQDLEKLDEELERIK
TQLGNATASASSQDKLRKLEKNVADIKSLVSKFSSAVNNQKPRVDQLDEDTDNLLKDMNT
LNEKVQDRAADADRAVTEADKTHKRAKDLYSEVEKLRKKIQDLLQKLKEAGTTLPSKDLE
KMLRDAKRMVREMENRNFTPQKTAAEKEKDEAKKLLEYIKANVSRQYDENNDTAEKLQDL
LKAYEAKLKDLDQALKDAEDLVKKANVQNGLNGQTLGNLQKQATELKKERDMVKGQMDMA
RNELKKTQDLLKMLTDSKTEYEYLAAQLDGAKNEVTKKVNELSKAASKEDIVEAAEKHAQ
DLAKMAKELEDAVKNASGRTEVRNARDAIDAYKNITDAINAAAAAANEAKTAADRALNSV
NSQRLTERAKNLKDNSEDLLTEAERTDKDLTKATSDLRNLNLRLIDADSKKKALQKNLLD
AQNQLRNIRDMINEAKRKSASANKTASETMDKVSAIKEEISKIGVSPSDGNLNNVLTDVN
QTINNLLQSIPTLNDKISEVKNLTSQFSQINNITGNIKKIKELIEQARDAANRIAIPMKF
SGTGHVELRPPTDLDDLKAYTAMSLSLQRPESRGDGARRRRQNPESADMFVLYLGSRNSS
KNYIGMVVRNNVLYGVYKLNGQEYKIQTETIIRSPSEPAKFDRVDLNRIYQDAEITFTKD
TSGTSPVSSKTNNIGDDSKNLLDLSPGDVVFYVGGYPANFTPPDSLNLPMYDGCIEFFSF
NDKAISLYNFRARDKINLQTPCKSSRYVPPVTSNYYEGTGYSRVPIDKQSSILLIAMSLY
TRSENGLIAYFSHEFFLFPTQNNYFAVTMEKGVVFIHSNLLESPVTSNLKLFPVGIIGDK
VNGKMTVRVASKEAAVANVKYNFDEFTELYVGGIPEAMRERYPFVFLSVFPFKGCLQNLK
INKGFQPPTEQVGVSKGCPVSSLVIRKAKFDLGSALSSDLQGFSLDNKVTVSLGFKSTQS
RGLFLQDKQLANGMNLELQNGHVVLKFNDKMWRSNKQYDDDQWHYLTVTRSAGRTELLID
DEDRGQEESGTSINDTGSLLILGGNEFRGCVSNLYTRRPNSLYKAEDFSTFQSSGDVLLD
VCAADSPAQLMRDRSAKKDVPMQDINEMSPCASPATVKHAYRMYGSVSSLSFSLPLQVLQ
PRPQISLDVRTRAAEGLLFFAATRGGRAHLALYMSKGRIRLSVGKEKEIFNREKYNDGKW
HTVMFSLEKRLFRLVVDGIRAQDGQMVNAELAAMQHFLSPVYLGGAPEAFHKESKGLPKQ
SVPGCIRNFKMNGALMTNPTTNRGAGPCLAGPTQKGAYFAGNRAHVIVNDSFVLNSTFEL
LFSIRPQSPTGLLLHVGVFSESHYLSVYMLRGEVVAQANSGKGELKVTVKPKTSLCDGMF
HKISVIKRKNVIQLHVDTVDSYKIGPPLPATTLTKSSLYVGGIPETLVQQPLPVRASFVG
CIQDMSVNSEPVSFERPPAVFGPVNLKECPG
Download sequence
Identical sequences H3DCP0
ENSTNIP00000018283 99883.ENSTNIP00000018283 ENSTNIP00000018283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]