SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018442 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018442
Domain Number 1 Region: 618-685,893-1233
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-120
Family Ras GEF 0.0000139
Further Details:      
 
Domain Number 2 Region: 221-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-39
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 3 Region: 23-130
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-19
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 4 Region: 431-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000283
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018442   Gene: ENSTNIG00000015378   Transcript: ENSTNIT00000018668
Sequence length 1236
Comment pep:novel chromosome:TETRAODON8:12:3353558:3375702:-1 gene:ENSTNIG00000015378 transcript:ENSTNIT00000018668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALFLSVVARKEGTKRGFLSKKTAENSRWHEKFFALYQNVLFYFENEQSA
RPSGIYLLEGCTCERVPAPKMSTTGKEALEKQHYFLVVFGHDGQKPLELRSEEEGDCDEW
VEVIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIVA
LNKTKERMRPYHIIHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHGLKARLANWPTLVLERDLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
VMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLVCTRSSGGKLHLLKQGGVLSLIDCTLIEEPDTNDEEAKAGG
QVFGQLDFKLVVEPTDSPSFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENS
KVTVPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNT
FLHTYRIFTTAVVVMDKLADIYKKPFSSIPIRSLELFFATNLNNRGTSDTNDKSPRLRRK
FSSPPPLSIPSRTSSPVPTRKLSLHSPITARVGGLDLTTPTSTTTSPPPPSTSPPPNCSK
SPQEQASPVLSSPDLSPCANSEAEEPPKMDPFCGKLRRSIRRAVLESASLEKILPDAAQN
SEAGDVSPCRSPSTPRHLRYRQAGVQSGENSRCPVSPASAFAIATAAAGHSSPPVFPNSE
RTCDKDFIIRRAATNRVLNVLRHWVSKHSQDFEMNRELKLSVIGLLEEVLRDPDLLPQER
KATANILSTLSQDEQEDAQLRIEDILQMADCPKAECFESLSAMELAEQITLLDHIVFRSI
PYEEFLGQGWMKVDKMERTPYIMKTSQHFNDMSNLVASQIMTHTDVGSRSSSIEKWVAVA
DICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRE
TLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYR
IEHQAKVTQYLLDKTLIMDEDTLYDLSLKIEPRLPA
Download sequence
Identical sequences H3DD49
ENSTNIP00000018442 99883.ENSTNIP00000018442 ENSTNIP00000018442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]