SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018444 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018444
Domain Number 1 Region: 27-265
Classification Level Classification E-value
Superfamily Ras GEF 1.12e-94
Family Ras GEF 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018444   Gene: ENSTNIG00000015379   Transcript: ENSTNIT00000018670
Sequence length 268
Comment pep:novel chromosome:TETRAODON8:12:3345409:3347217:-1 gene:ENSTNIG00000015379 transcript:ENSTNIT00000018670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLSQDEQEDAQLRIEDILQMADCPKAECFESLSAMELAEQITLLDHIVFRSIPYEEFLGQ
GWMKVDKMERTPYIMKTSQHFNDMSNLVASQIMTHTDVGSRSSSIEKWVAVADICRCLNN
YNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPP
CVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQAKVT
QYLLDKTLIMDEDTLYDLSLKIEPRLPA
Download sequence
Identical sequences H3DD51
ENSTNIP00000018444 ENSTNIP00000018444 99883.ENSTNIP00000018444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]