SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018459 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018459
Domain Number 1 Region: 110-158
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000445
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 73-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000464
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018459   Gene: ENSTNIG00000015392   Transcript: ENSTNIT00000018685
Sequence length 286
Comment pep:novel chromosome:TETRAODON8:12:3130088:3137254:1 gene:ENSTNIG00000015392 transcript:ENSTNIT00000018685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGRKSSTYRWECVRGSKKQTKKVSTMGAHGWSSARVGWVVWGYFAFFCGELFPRAEAGCR
VRKSPSCCTGRNNDCFEYTRSKTLCYCDGYCQKTGDCCEDYRRVCQISAIDCEVGPWGPW
SPCTSSCGVGSTERSRQVSVPPRNEGRPCPDLKQRRGCFGNAVVCRRGTANTSVPKLLPA
ALFQNSHLCRSQKNARTPSYCVYLRVKRASVACQLKPWSAQLVKERLVCAECQGDAMSKS
DRCGGDGIQNIRTFWSAASVPGCHGSWVRETSSEVCRCPRSSVLFV
Download sequence
Identical sequences H3DD66
ENSTNIP00000018459 99883.ENSTNIP00000018459 ENSTNIP00000018459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]