SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018477 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018477
Domain Number 1 Region: 678-893
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-98
Family Thrombospondin C-terminal domain 0.000000176
Further Details:      
 
Domain Number 2 Region: 551-676
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.89e-26
Family TSP type-3 repeat 0.0000237
Further Details:      
 
Domain Number 3 Region: 483-553
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.93e-17
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 4 Region: 184-222
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000275
Family Assembly domain of cartilage oligomeric matrix protein 0.0016
Further Details:      
 
Domain Number 5 Region: 406-494
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000392
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 6 Region: 20-144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000496
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 7 Region: 235-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000272
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018477
Domain Number - Region: 325-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000152
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 372-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-like domain of nidogen-1 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018477   Gene: ENSTNIG00000015409   Transcript: ENSTNIT00000018703
Sequence length 911
Comment pep:novel chromosome:TETRAODON8:12:2913407:2927109:1 gene:ENSTNIG00000015409 transcript:ENSTNIT00000018703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPDCLPDLLQGSLQKGRDEAFLLSSFRLQSRAPTSLYSVVNPKDSSKYLELSVQAKLSKV
TLRYQKIDGRFATTSFNHGSLADGRDHHMMLHASGLQAGPPRLNIYIDCRLVHTMNDLPA
AFGALPPGPNTVALRTLPTVGQDKLTDLKLVVEDTVDNVATLQDCHMDQGQPLQLLGQNT
GKKPNRLTELKSMFAEMKELLQQQIKETNFLRNTIAECLACGKQCPGTVILNPTCPPGTC
FRQSMCIPAESGGFRCGPCPDGYTGDGMRCDDVDECQFSPCFLGVTCVNTAPGFRCGRCP
LGYTGPELTGVGVSYAKSHKQACEDIDECLGPPENGGCTANSHCYNTMGSFRCGDCKTGF
TGDQVKGCQNSRLCPDGQPSPCDANAECIVERDGSISCVCGVGWAGNGYKCGKDTDIDAY
PDEKLQCRDKACNRDNCVFVPNSGQEDADGDGLGDACDNDADNDGISNTDDNCWLVANVD
QKNSDKDAHGDACDNCRSVKNPSQRDTDKDGLGDECDNDRDGDGVMNPRDNCPRVPNPEQ
ADRDGDGVGDACDSCPDVSNPNQSDSDDDLVGDTCDDNIDRDGDGHQDNKDNCPATINSS
QLDTDKDGMVLSRRGPLEEEGVCASASVLLNRCRLVANSDQKDSDANRVGDACEGDFDKD
SIIDIIDHCPENAEITLTDFRAYQTVVLDPEGDSQIDPNWVVLNQGMEIVQTMNDPGLAV
VGYTAFSGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQAAPFRAVA
EPGIQLKVVKSKTGPGEYLRNSLWHTGDTAEQVRLLWKDPRNVGWKDKVSYRWFLQHRPQ
IGYISRARFFEGSDLVADTGVIIDTSMRGGRLGVFCFSQENIIWSNLKYRCNDQIPDDYQ
DAQAQEHLHPL
Download sequence
Identical sequences H3DD84
99883.ENSTNIP00000018477 ENSTNIP00000018477 ENSTNIP00000018477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]