SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018497 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018497
Domain Number 1 Region: 36-185
Classification Level Classification E-value
Superfamily Lipocalins 0.0000000000502
Family Retinol binding protein-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018497   Gene: ENSTNIG00000015428   Transcript: ENSTNIT00000018723
Sequence length 206
Comment pep:novel chromosome:TETRAODON8:12:2723287:2724747:1 gene:ENSTNIG00000015428 transcript:ENSTNIT00000018723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQLAVALLALASLCAASDLNCKELVKPLVLDSHSPIYGKWVLHVGSWDKAGLKNDLVS
VDSAWLELSASSDNEFINLYWADRLKDKCLQGLANATVSGMTTHTTFNINGHTSYHDGKY
YETCSDCLLSEDTTLLPDGKSKGRYLFLYTRSGLLEPAHFETFKKQAECLGFPPHYHFVS
TDLCPDARQAAAEKMEKDEASHPAAN
Download sequence
Identical sequences Q4RUP8
ENSTNIP00000018497 ENSTNIP00000018497 99883.ENSTNIP00000018497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]