SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018500 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018500
Domain Number 1 Region: 43-190
Classification Level Classification E-value
Superfamily E set domains 3.08e-17
Family Arrestin/Vps26-like 0.026
Further Details:      
 
Domain Number 2 Region: 197-326
Classification Level Classification E-value
Superfamily E set domains 2.24e-16
Family Arrestin/Vps26-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018500   Gene: ENSTNIG00000015431   Transcript: ENSTNIT00000018726
Sequence length 393
Comment pep:novel chromosome:TETRAODON8:12:2648223:2650095:-1 gene:ENSTNIG00000015431 transcript:ENSTNIT00000018726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSKCNHKKRRRVGQASVASWFSTFGDHCWRRMTITNFSIEYDAINSRNTFTNGDTINGR
IVVEVSKETTIQALIFIGQGEAQVCWSEQLGLHHQQQYQQNEKYYKIKHYILKESRQDGT
EVIGKGRHVFPFSFQIPDRNIPSTFKSSVGKIVHKLKAELKQSLRLTKKARTHFTFVSKA
NLALLTLMEPQYGCRNKSLTLSSGGVFMHIKTDRMGYMQGETIQVTLEITNCSCRSVKPT
FALYERQSFFAQGKRTVHARNILKVMAEAIEGGKKKAVTQLINLPMELPSSIFNCSIIKL
EYRLKAYLDNKCARDPEVTIPIVVLPNLRGPAERSPPAAAGIGLEGFGSPDRSQQTVLPR
QQASLDQEDQPPSYEACAMYPPLPDYKEYQNTL
Download sequence
Identical sequences H3DDA7
99883.ENSTNIP00000018500 ENSTNIP00000018500 ENSTNIP00000018500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]