SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018503 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018503
Domain Number 1 Region: 3047-3198
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-42
Family C-type lectin domain 0.00000407
Further Details:      
 
Domain Number 2 Region: 149-256
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-36
Family Link domain 0.00094
Further Details:      
 
Domain Number 3 Region: 254-354
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-26
Family Link domain 0.0053
Further Details:      
 
Domain Number 4 Region: 30-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000218
Family V set domains (antibody variable domain-like) 0.018
Further Details:      
 
Domain Number 5 Region: 3199-3259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 2994-3031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018503   Gene: ENSTNIG00000015434   Transcript: ENSTNIT00000018729
Sequence length 3272
Comment pep:novel chromosome:TETRAODON8:12:2579879:2602757:-1 gene:ENSTNIG00000015434 transcript:ENSTNIT00000018729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPNIKHILWLYCLCEVATATDSNSLSIIRPVTGSLSGKVNLPCFFSAIPTSAPVISPNG
TIYPRDQLRIKWSKVERHVETTVLVAQNGVIKIGPSYRNRVSVPSHPENVGDATLTMVKL
RASDTGTYRCEVMYGIEDTQDTIDLDVNGVVFHYRTNTSRYNLNYQEAVQTCQDIGATIA
TFDQLKSAYEDGFDQCDAGWLAEQIVGYPITKPRNGCYGNLQNKPGIRTYGKRKLTDTYD
VYCYIDKLEGKVYYSPAKNKMSFEEARKECQKENAVLANPGQLHAAWRLGLDRCDYGWLS
DGSARHPVAVPRIQCGGGLLGVRTMYRYKNQTGFPEPATMLGAYCFRGKSAETIDTSILI
LITEKKIKKAGQLLPALNTKAKDIKSSEPLDPTDSPFMFSASMAPPRPTQAGQKEDLITT
VAPTIKEDRDDLPDLDTDSFAKHSGSTLMETDVRTEIDPEFFTSYTITSHTTRSPTAAPT
HTDRTEQSSQLTIAAHLQHSVTVTSSSSVSEHPAPSLPDGESTLPSKKPDLFSKATVTVI
PTVGFENDKHEITLEPHSPEEREAKGTQTVTNVTMLGEKDPTTATVMETSRVILHVKYNE
PEAIPKRVESPPHKRPDANAVTTNSSTQDAEGGNYSAGAKPIFTSPAPPAQTHKTDATLA
LEIGSSASASLASQLLATSAETASLSSSSQETDLVVEGRTVQTTKTETFKGLEQDHTATP
VFSSLHGTIVTQTPVDLTEKAATDETSVERSVNITSSVLKPTNEFHFEGQTISPGHITED
LSYNISLTTTSSSVLSASRETMSKQSKETSSSSTIPDLTLSSSAAEKSPANVEVTDPTVT
PSFTKSVFTEDGAAAFQTEQPSVSPLTDETTSVKDRDSEDQPYNFSAVILPSSTETKDMD
SQTVKPSVSSTDAPKVTSPITTSNVVQDNTKVPSPKDQTLDVKTSSVPSFQSGSTEITGL
SSLSFVTTTEKPTALTLFKDDITSTKKSSVPSETDKTLQVFTSEDGSGSGDEIQDLLTQS
SSVTAAPFDDATEKTLPVSANITETQPSVFPVSAETISSESPMVESLPSFSRSTMSPQTS
SMSGSRYTERFHDSSVDLSEEAFVLEATVSSFSSSSSTNPPSVITDRKIGTMRETEKETA
TAETRTMFPTDDEESSGEEPTEITLKYSTASPLISTEEPTVLPDINEDKSLTTAKFPDHH
RFISTSLLYSTEEPSSASMDRQESTSRTEKETAAAKESFKLPTTEEEVSSGAEPTETLFK
YSAASTASSLFSTEKPTARPVIKDDTSSTEKSSVSPETDKTLKVFTSEDGSGDEIQDLLT
QSSSGTAAPLDDITDKTHLMSAGTTEFPDMNDINTEGPQPISDDKHEITSGTEKQTTTKE
SSEISTEEEESSGAEPTDTSFKYSAASTASSLFSTEKPTALPIIKDDTSTTEKSSVSPET
DKTLKVFTSEDGSASTASSLFSTEKPTARPVIDEENAATTLYSTEGPQPISDDKHEITSG
TEKQTTTKESSEISTEEEESSGAEPTDTSFKYSAASTASSLFSTEKPTALPIIKDDTKKP
TARPVIDEENAATTLYSTEGPQPISDDKHDITSGTEKQTTTKESSEISTEEEESSGAEPS
DTSFKYSAASTASSLFSTEKPTALPIIKDDTSSTEKSSVSPETDKTLKVFTSEDGSGDEI
QDLLSQSSSETAAPLDDITDKTHLMSAGTAETLDVGSHISEETSLTSEPAGTSASSLFSV
KEPPSSSSPKTDREILTMSETEKGTTETRTMFQTDDEETSGEESAEITLKYFTASPGFSL
LSTEKPTALPDIAMTTEKSPVHHSFTSVSLLYSTEEPSSISVVRQTEIAKGKGSPKLPTT
EEEESSGAEPTETLFKYSTESKAFSEFSTKKTTALPLIKQEVTITRETDGIINLPDGFIE
ETSTVMDSDYQSQKKLSQQSSVTIKSSLYSTEAPTPSSSHGTKKTASVTSSHSSTESTMK
LEIESLKFNMDEESSGDSTTEQDFFILSTVSLPTEQPTVTNGSLETTESDSTLVLSSSLY
NIEKNTFTPAQQMTKQAETVDGSVSAVNEEDAKMLFPDEDDGSADVVATVDSSKLFTDTP
PTVFKEGMVVDAKTETPIISKEILTTTTISSVTTSLERMTVSSPPTGAFRSQATAASPLF
STEKPTAAQPIVSAGVQHQYPFSTATSKSGEVSLLHQVETSTQTLPPVNFTNSAQISTTL
NESVPSRSKMGQGDFVKVEHPSRDENPLLPTQTTHFSSTDFFLTEQGSGDLTDDSEGSAT
DSPIARYRKSPKNTAKDAEHLVTTKPLDLGAEKYDVTDTETHVYDGNTSSSTFGSLVSDL
AKDFSTLSSIPSSSFYPSIQTEEAGGITAVTMTQNIEVTEESEGSGTSTPVTLSSEESSK
EILPSAPREVPMSAESTESSAEETTAVPTHTTSEKAGGALGTAAQTEDLLSTVEEETVTD
TPSTATSSILAVLKPEEAQFSVFLPESGTRETEEQVSSSSTSADNISVTFPPNPTVEDDN
LDTNEALTVPAAHEHSKEKVDKILSLTTLSLPVITDGLLKAGLEGSGDEILEATAASQKP
TTAPREDESKSEETGLSHDEIFSASTEESQVSTLESTSSEVKVQFVTTFVPEANTRPSEV
SFEQRRSEISITLPLQINTDAEETVRTTTSRLIPSDTSSHKTESGYDVTTMPPHGFIPTV
LSQTPTTKNVSTKEESPDFSTLTPEGPDGTSSPGLHLKTTQKSSGQVSSEIPVTQRPYAD
VSSAAVLLMTTDTEGQETNTAPSFVSKTYESRLVDLESSNETSSEETSTTSPKLVAQGVN
VGTLTTVSWSSESGSKSSSSEEVMSTVSMIKPDGDGAESVTQTFLPTSSTEGETGSTVST
SESVSSESVSEEMAIARTPKNDSVEEQPHGEIQTVFKVDTTTATASPALNPTEAEASVFA
NQAAFSEKDKTPDTNITAPPLLPGEKPVMKEHEPTATGLHSGVTVDGEPVEIPEVHSCTE
NFCLNGGSCHKNGAVHTCSCAPGYAGDRCQTEFDECHSNPCRNGGTCIDGLASYTCDCLP
SYSGRNCEEDTQSCHYGWHKFQGNCYKYHPQRKSWDAAERECRMQGAHLVSITSHEEQQF
INRLGHDYQWIGLNDKMFDNDFRWTDGSALQYENWRPNQPDSFFTSGEDCVVMIWHEDGQ
WNDVPCNYHLTFSCKKGTVACSQPPLVENARTFGKKLERYEVNSLIRYQCRKGFIQRHPP
TIRCRGNGHWDAPKISCMNPSNYQRLFFRKHY
Download sequence
Identical sequences H3DDB0
99883.ENSTNIP00000018503 ENSTNIP00000018503 ENSTNIP00000018503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]