SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018595 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018595
Domain Number 1 Region: 75-312
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-82
Family Eukaryotic proteases 0.0000329
Further Details:      
 
Domain Number 2 Region: 21-56
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018595   Gene: ENSTNIG00000015524   Transcript: ENSTNIT00000018822
Sequence length 313
Comment pep:novel chromosome:TETRAODON8:1:16199789:16202242:-1 gene:ENSTNIG00000015524 transcript:ENSTNIT00000018822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAFFFLVLVFGVFVGVVLGKGCDSTFTCDSGECVTKLNPECDFVSDCADGSDEARCGELL
LPLLAPLWYHTAEGVRPWGPELVGGEDAQEGELPWQVSLRLKGRHTCGASIINQRWLVSA
AHCFESDRDPKEWTALVGATHINGEELQSRTINIKSLLVSPYYNSFTSDNDVTVLELETP
LTFSTYVQPVCLPSQSHVFVPGQRCIVSGWGALHQYNPKLPTTLQKAVVEVIDSKVCNTS
SVYSGGITGAMMCAGFLQGKVDSCQGDSGGPLVCEGAPGRFFLAGVVSWGVGCAQINRPG
VYSRVTMLLKWIL
Download sequence
Identical sequences H3DDK2
ENSTNIP00000018595 ENSTNIP00000018595 99883.ENSTNIP00000018595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]