SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018669 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018669
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-27
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018669   Gene: ENSTNIG00000015595   Transcript: ENSTNIT00000018896
Sequence length 1658
Comment pep:novel chromosome:TETRAODON8:12:4802432:4838357:-1 gene:ENSTNIG00000015595 transcript:ENSTNIT00000018896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDVDVLQLLGLSGRITGSSGPSGIRSVPNGVIPSKTGVILTPRARIQAPLHTVIPATYNR
TNLSLVLSLSVHRINSAFLFSALSKKKKVQLGVQFAPGKILVHAGQRSPVRFDYDVHDGQ
WHNLALDIQGHQVLLYTSCGKNSVHADLRVKKEEAFDANGTFLLGKANHNAVSFEGAICQ
FDIYPSAKAAQNYCDYIKKHCREADTYRPAFPALLPLFSTDSNITVTSPSSTPIKGIFKS
NMKPTLGKTTLPVPDYSLLMLNKTSAYHTVTPPKPGAASVSPAAHPELESSFMFPTQTVT
SLFRINMTPPTQKPALFKSAKENTRHEDANVSVKKLFQPKGTRTQHVGPTPLVPVTLAAT
DGFQTFDLEPKRPILCASTHFVCFTGSMQNQLIDSKLGLYLQDPHFHGYHGYCYKWHDSL
YVWHLRTIIEFFFLLSAAKDLFPQGPRGLPGLPGKPGKRGPRGLPGSHGNPGLPGPVGKK
GQKGDPGLSPRQATKGQKGEPGVMGPPGLPGHTGRKGQKGHCGFSGLPGEPGQRGDDGSS
GAKGYPGRQGLPGPVGKIGPKGIRGHIGFPGHFGYPGPDGERGIPGGHGKKGEMGRPGFP
GDFGEMGPPGPDGIPGELGAPGPVGVTGVIGDIGPVGNTGLPGLPGIKGVSGNPGEPGLT
GDKGDVGLTGEPGELGFQGDKGACGPPGLPGPRGNPGPLGQPGENGPVGLRGPPGPEGFP
GNMGPPGKNGPQGLKGKEGTRGFPGLRGMPGAQGDEGPAGPPGPAGLEGRPGRQGFPGLT
GLDGLKGELGINGEVGKLGERGLPGFVGPPGQTGILGEKGDRGKTGAPGLPGETGPEGHL
GIPGETGVPGHQGMPTQGPPGLRGSIGIRGPKVFLGLTGLDGLVGDEGSTGLKGPEGPPG
KLGLPGDMGKLGEPGEPGPKGFPGVPGPSGPRGAKGITGEPGPAGPAGTIGPLGEMGPSG
LPGKAGKSGLPGESGMKGIPGQPGSVGEPGLIGQRGEPGMDGEAGTNGNDGAKGERGDAG
PNGTDGDIGEIGLKGIEGPSGPPGLTGVRGQEGSPGKIGEKGMPGQKGSKGHGGQLGEIG
PAGEQGEVGFVGKKGTRGTIGPVGAPGRMGQQGDPGMAGYQAHMGPQGPQGPPGPKGEKH
VPSVQILTLLTHQGQRGKPGDPGHIGQNGIDGKRGEAGAPGVPGLPGPKGQPGPKGSKGD
QGQKGKSGARGATGSRGPPGPQGPSGPRGVVGREGLEGPPGMDGRHGKDGSKGLKGEQGD
DGKVGLPGKPGNLGKTGTAGHPGVQGFSGPKGEKGLPGHHGASGRRGPIGSIGLPGKQGX
PGERGDKNAFNEQGRIDSLSFIYVVGPPGDTGPAGIQGPKGPCGLTGVEGALGPTGIIGP
SGHPGAQGDRGSRGETGSPGLRGPPGPPGFPSFPILFKSKARGSTFQVLVDSDAALRPQV
RLIFQSMEPPLLDHGTAIFQTLQQISTMIQSLKNPVGTRDNPARICGDLHNCEQKLNDAT
GTYWIDPNLGCAADTIEVTCNFTGGGQTCLKPVTVSKMDIDVSRIQMNFIHLLSTEAVQH
ITIHCLNTPVWAEGAPLHPSDKAVSFKAWTGEKIQAGDLLEPLVPRDDCWIKDGHWHQTH
FIFQTQDPNLLPIVEVSNLPSTEQGARYHLEVGPVCFL
Download sequence
Identical sequences H3DDS6
ENSTNIP00000018669 99883.ENSTNIP00000018669 ENSTNIP00000018669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]