SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018674 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000018674
Domain Number - Region: 230-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number - Region: 142-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0829
Family Laminin-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018674   Gene: ENSTNIG00000015600   Transcript: ENSTNIT00000018901
Sequence length 801
Comment pep:novel chromosome:TETRAODON8:12:4596725:4607180:-1 gene:ENSTNIG00000015600 transcript:ENSTNIT00000018901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELNPKGKNVCKVQGSSGLVCCSGWAQLGNECLTPLCEGNFTCKENEVCVRPNECRCRHG
YFGASCDTKCPAQFWGPDCKGKCNCYPNGQCDDLTGKCTCNHNRWGPNCENACLCQKGKC
DQETGKCTCHPGIWGPQCNNNCYCSVNSICDAMTGRCLCSPGWTGRNCGIQCSCNNSPCD
QFTGRCQCRERLWGPRCERYCQCVNGKCNPTDGSCTCTPGYRGKFCREPCPAGYYGQNCR
NRCGYCKGQQPCKVTEGRCITCDRGWNGTRCDQLCSKGFFGENCQEVCPTCKDGHHCDPI
HGKCSHCNPGWIGDRCEVRCPNGTYGENCENNCHHCFNGICHVVTGECLCDPGFYGTYCN
RTCQPGQYGVNCNQTCSCHDKICDPVSGACYLQPNQRMGVIAAGSLVSFLLIVLLSLLFC
CCLCRHKEDHNNCSNSKKAKRILCGRFSRISTKLPRIPLRRQKLPKVVVLVAHHDQENTF
NCSFIEPPSAAEQPPPSSWSSQESFSSFESREEERVYCVPHEESVNESKEKRSHSPATDD
AGEYTSLKDTSIAKSEGSEQPFHKSSDSDGSTSGSDSTTPALYARIARLSKQSKEEDGVS
KPPSPGKPKPRPPDPSTKPKVSWIHGNVPGSPQPEQQGVIKVLTVAKEIKRSSSDGSVKS
EDQQKIKEKGPEQQKKQEWKEVRVNGSPSKHKSVRGKKNSEAATLLAAQLKEKTQSINRK
PKEPPPPDRVTRAQKMVAPVTTDLDVPEAKSPEKQDLNGSKAADPTLDCTPKKTPIKKPP
RKKGKEGTLDTAESKTAQPKT
Download sequence
Identical sequences H3DDT1
ENSTNIP00000018674 ENSTNIP00000018674 99883.ENSTNIP00000018674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]