SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018775 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018775
Domain Number 1 Region: 4-455
Classification Level Classification E-value
Superfamily Sema domain 1.31e-141
Family Sema domain 0.0000000696
Further Details:      
 
Domain Number 2 Region: 807-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000523
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 567-617
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 4 Region: 755-808
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000301
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 451-501
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000558
Family Plexin repeat 0.0052
Further Details:      
 
Domain Number 6 Region: 622-673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 7 Region: 865-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000103
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018775
Domain Number - Region: 505-562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018775   Gene: ENSTNIG00000015700   Transcript: ENSTNIT00000019003
Sequence length 1051
Comment pep:novel chromosome:TETRAODON8:2:20506658:20539027:1 gene:ENSTNIG00000015700 transcript:ENSTNIT00000019003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLCLSALSPWISSFSHPGVRDFSQLTLDLSRNELIVGARNFLFRLNLSNMSLIQATEWAP
DEETRQSCQSKGKTEVECQNYIRVLLVNKTEIMTCGTNAFQPLCISREVGNMSRVLERVN
GVARCPYDPRHNSTAVVTESGELYAATVIDFSGRDPVIYRSLGGMPPLRTAQYNSKWLNE
PHFISAYDIGLFTFFFLRENAVEHDCGKTVYSRVARVCKNDIGGRFLLEDTWTTFMKARL
NCSRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITRAFNGPFR
SQENPRSTWLPTANPVPNFQCGTITDEGPNEGLTERSLQDAQRLYLMNDVVQPESVDPLV
LQDDVRFSNLVVDIVQGMDTLYHVMYISTEYGTILKALATPNKNLQGCYLEEMELFPAGV
RQPILSLQILHSDRSLFVGLNDRVLKIPLERCSTYTSEMLCLEARDPYCGWDFRQRRCTT
LEDSSNMSQWKQNISACPLRNQTANGGFGPWSPWQPCNNDDGGGGGADGVSSCLCRSRSC
DSPVPRCGGGNCQGPTIEVCNCSSRRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPR
HGGRVCVGPSREERFCNDGMACPQPIFWSPWASWTKCSSQCGGGVHSRVRTCENGNSCPG
CALEYKACNLEACPEVKRNTPWTPWMPVNVTQGGARQEQRVRYLCRAHLPDPHELQIGRR
KLETRFCPNDGSGLCETDTLVEELLKTPVTRVAGASWSSWDTWSSCSQSCAKGYRTRRRS
CAGPEGKSAPVACRGSPVEYQDCNVQPCPANGAWSCWSPWSSCSVGCGGGHYQRTRSCTS
PAPANGGDICLGLHTEEALCNTHPCDGGWMAWSLWSACDESGLQMRSRVCDAQGGAPCVG
NSTQRRDCNEIPVILPASGFDKDNDCGAFTSIHLIATGVSCFLGAGLLSFLIYVYRQRVH
KPSQESAVIHPTTPNHLNYKGNTTPKNEKYTPMEFKTLNKNNLLPDERSNIYQAPLQQAN
VYTTTYYPTALGKYDYQPNSSPSPCRTYNHS
Download sequence
Identical sequences H3DE32
99883.ENSTNIP00000018775 ENSTNIP00000018775 ENSTNIP00000018775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]