SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018886 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018886
Domain Number 1 Region: 822-901
Classification Level Classification E-value
Superfamily DEATH domain 1.57e-23
Family DEATH domain, DD 0.0000278
Further Details:      
 
Domain Number 2 Region: 212-263
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000536
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 144-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000209
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 268-315
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 5 Region: 15-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000177
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018886   Gene: ENSTNIG00000015804   Transcript: ENSTNIT00000019114
Sequence length 902
Comment pep:novel chromosome:TETRAODON8:12:7335836:7385504:1 gene:ENSTNIG00000015804 transcript:ENSTNIT00000019114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELPETFPSDPPEPLPHFLFEPEEGYIVKNKPANLYCKATPATQIYFKCNSEWVHQKDHTV
EERVDENSGLVVREASIEITRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAHVRVACCEG
TFVQTPMHHYVVMKFTHLVNNKPVTSTPTSQVEWLKNEEIIDPAEDRNFYITIDHNLIIK
QARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSVCNSRCGRGFQKRTRSC
TNPAPLNGGLPCDGQAIQKLTCTTLCTVDGEWTDWTVWSACGTECTQWRKRDCNNPAPKN
GGKDCEGLVLQSQNCTDGLCMQIILNFINTLDADHRDEDEEVSVFTTAPSTDDVALYVGI
VIAVIMCLVISVIVALFVYRKTHRDFDSDIIDTSALNGGFQSVNIKTARSADLLAAPPDL
TNAAAMYRGPVYALHDVSDKIPMTNSPLLDPLPNLKIKVYNSSGLVTPQDDLGGDFNTKL
SPKVTQTLLDNSDTMNLRNQSLARTRDPSCTAHGSFNNQGGHLIVPNSGVSLLVPAGAVP
QGRVYEMYVTVHRKDSVRPPVENSQTLLSPVVSCGPPGALLTRPVILTIHHCADNVQEDW
LIQLRNQLAMGEWEDVVVVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSVCKAAAK
RLKLAIFGPVCCTTLDYHIRVYCLDDYQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHN
LRLSIHDVPHMHWKSKLIAKYQQEIPFYQVWAGSQRTLHCTFTLERLSSDTAEISCKLCV
RQVEGEGQIFQLSNTLEEDVQCIDTSLMDPASNITTLVGPNAFRIPLSIRQKLCGSLDAP
QTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRS
DS
Download sequence
Identical sequences H3C224
ENSTNIP00000018886 99883.ENSTNIP00000002292 ENSTNIP00000002292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]