SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018906 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018906
Domain Number 1 Region: 187-324
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.67e-40
Family Cap-Gly domain 0.000000411
Further Details:      
 
Domain Number 2 Region: 40-152
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.37e-34
Family Cap-Gly domain 0.0000152
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018906
Domain Number - Region: 808-927
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000183
Family Myosin rod fragments 0.0031
Further Details:      
 
Domain Number - Region: 1106-1202
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0254
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018906   Gene: ENSTNIG00000015823   Transcript: ENSTNIT00000019134
Sequence length 1429
Comment pep:novel chromosome:TETRAODON8:12:7007668:7020878:1 gene:ENSTNIG00000015823 transcript:ENSTNIT00000019134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTAKSTGIKVPSKIAKPSGPTAPKTNPTSGISAGSKVAAPDKSASSAGGDVQGVEENFQ
IGERVWVNGNKPGYVQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEALRGIFT
RPSKVSRTEGEANGNQTAPPSRAASPTPSVGAGASSAAKAKSALPSTTAATKKASSSTPA
PPATPTSNLARTNSESVSNLSETGSVKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKG
EWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVRKTV
ATPSGLKRSPSSSSVSTMSSVASSVSAKPSRTGLLTETSSRYNRKISGTTALQEALKEKQ
QHIEQLMAERDTERAEVAKATGYAGEMEAELRLLREDQEQVTFHRMEAKMDQLRALVEAA
DKDKVDLVNQLEEERRKVEDLQFRVEEACITKGDLEEVTQPLCLFENTQTRLEHYHIKEL
EQSLLFEKTKAEKLQRELEDTRVMNSPLQCAALEKGGPGLGKSGQRRFFKECREVPNANW
SAFSLLVCVQDTNFKNGITTFNHKRMSSSLSKQFFSKERSRIMELERHLVTANEGLSGDN
EQMQMRLSHAKENAESVELWRSKLESAVASHKEAIEELKVSFSKGAGVQMEELVETKSAL
ERLKLEHTLALEEAGAKQEAAARVWAAEKQAADARLLALTEERERLEDALRSSVERAEEQ
HLVEMEDVLGKLHAAELRVKELEERETVLTQQTEDKDRETKEQMAEMVALRSQVAQNNEE
MVTLKKQLEVVQSQGSDQGAKVVELSCQLESGQQEVLSLQKSLAASKQEKEALDKELACL
KQNLSESTEEKTKSAKTMQEALDQLSKKEEEYTSLTAESETLRSQLAGLERKLKTAAEAL
EQHVKDKRKLETDMSEMMKQSGDSSAQLTKMNQDLIEKERKLEDFQSQLAEEKNKVALLN
EQAEQEKSHKDRELKETKETHQSQVNDLQEKIRSLEKAVKEGETLAEELKASQQSSVSQA
SELHAKEVELLQNQVDKLEQELSSSKRAEEKEGLLVQLQEREKQATETSGKAAAALEQLR
EEKDSLMKEKNDAQTQLEELKSCKQEMEMEMKELRAENSKYHEDLSASKEQLCTETQRTK
SLCQEIEDLKTADSAKTQSLQALKDENDKLTQELDIAHGGQSELTKLRKENSELQNQLEE
SQKSASTFREQSDGEKAALQQSMRKNSALIAEKEQLVQKLRSEVAELHSRGAAVPSLQGA
VQALEQDKKELEERAQRLEEELAAAKNTLSLPSGDAVLDQLREDKETAESQIQFLNSVIV
DLQRKNEELKEKLEKVAAAALNGNNPSELDNYEDHDKEPAKKKPPPRLFCDICDCFDLHD
TEDCPTQTQMPDSPPHSTYHGSKGEERPYCDICEVFGHWTEACNDDQTF
Download sequence
Identical sequences H3DEG3
99883.ENSTNIP00000018906 ENSTNIP00000018906 ENSTNIP00000018906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]