SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018945 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018945
Domain Number 1 Region: 10-215
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000288
Family PBS lyase HEAT-like repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018945   Gene: ENSTNIG00000015860   Transcript: ENSTNIT00000019173
Sequence length 260
Comment pep:novel chromosome:TETRAODON8:12:6555162:6556167:-1 gene:ENSTNIG00000015860 transcript:ENSTNIT00000019173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILCVCSAGETSKTRSLLCQSMQALLETARTPLPDHWDQTLDLPQVCAVHTLQALVRGS
GLGVAVLQFAPAVAILSLTLLSSPCWAMRNAALQLFSSLCTRMLGQRPSGEEDGRHQHGM
SPPAFFHHYPGLQPFLLAELSGAAQELQDPSNEAKLHLQPSLFPVLTLLAQLQPGVQDAT
ATLSSFLPPLLQLSSSPIYNVRVMASRALVAMTPPSEYMSILSKLIVQLPGSQEPCCHNR
LHGQLLQIRAVLERALCSLR
Download sequence
Identical sequences H3DEK2
ENSTNIP00000018945 ENSTNIP00000018945 99883.ENSTNIP00000018945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]