SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019021 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019021
Domain Number 1 Region: 234-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.94e-56
Family Reprolysin-like 0.00053
Further Details:      
 
Domain Number 2 Region: 531-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000301
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 1444-1505
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000628
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 1290-1340
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 1395-1448
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000902
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 867-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 814-872
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000824
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Domain Number 8 Region: 934-987
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000706
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019021
Domain Number - Region: 1343-1399
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000615
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019021   Gene: ENSTNIG00000015935   Transcript: ENSTNIT00000019249
Sequence length 1545
Comment pep:novel chromosome:TETRAODON8:12:5865255:5876976:-1 gene:ENSTNIG00000015935 transcript:ENSTNIT00000019249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSRVCPLLLLLHLALLLAAGHQELELSAPGSVLSLFAEKESDLSIVHPVKTTADGGFI
SHSVSHHFKGGRFRRDLQACLEERVYYRVTYKGRALAFNLTVNPHLVSSDYVLERRNGGA
NRTEQPSSEGNSCHLIGTVETSEERGSAAVSTCGGLRGFFSLPEGQYFIEPIQTSSQNAT
EAPEPHIIYPRVRETHRKKRDAGPGATPGLCGVQDAPSDSVQGQARPRTQRSVSKERWVE
TMVVADSKLIEYHGSDNVESYIFTIMNMVAGIFHDASIGNAIHVILVRLILLHGEEKGLK
IVHHADTTLSSFCTWQKNLNPQSDTHPAHHDVAVLITRKDICAGMNQPCETLGLSHLSGM
CQPHRSCNINEDSGLPVAFTVAHEMGHSFGIHHDGQGNDCELEGRHPFIMSRQLMYDSSP
LTWSSCSKEYITRFLDRGWGFCLDDRPSKRDLSTPLARLGVRYTTHHQCQLQYGSNATFC
NEVDNVCQILWCSVNGSCRSKLDSPIDGTRCGPEKWCISGECVIVGKLPETVNGGWGQWT
TWSHCSRTCGTGVQSAERECNNPKPEFGGKYCTGERKRYRTCNTKPCQKDKPTFREMQCS
EFDTVPYNNELYQWIPVSNPLHPCELHCRPSTEYFSEKMLDAVTDGTPCFVNKSRSICVN
GVCKDVGCDYGIDSNAVEDRCGVCLGDGKSCEMVYKSFDEEEGLGYTDVGVIPVGARDIL
VKEVEEAGNFLALKSESSEEYFLNGNYIIQWNGEYVAGGTTFYYERGHMENLTAPGPTKQ
PVILQLLFQEANPGLKYEYSIRKTKVTGNEVTQPVYRWRHGAWTDCSTTCGLGDQLQPSR
CFEMDVGVVDESLCDAESRPEDRHRKCKTMDCPARWWVGGWQQCTATCGSDGVRKRTVLC
VRTMSGEERVLHPVECKHLLKPKPIVPCNRDVVCGQDWAVGVWGSQCPVTCGGGVRSRTV
MCAVSAKKTCDLSTKPRSRSLCALQSCPNSGLQRRPGHPPKYRRIYPPKNQPTRRPPPST
WAPSSAATSATPLASVTVMETTTEESTASNSKTTTSGIADGEFNIHLRKNDKLGKGFPSN
ADNSKDEREEEEEGSTPNMAGYTPGYDYVVEDRMTEEEGIIDLDVTTTERFKIPLQSTPP
TSFRSVTHTSQTGSTTMFVSKPPTTSSSSSHSTAKTWAETTQHHPVTTRPNHPHSQWTRR
IPLATTSVFHATQPPSTTARRPFTTASSARSTKKTIKVKKPAVTRKKNSLSPQPKKSASS
RSKSQSQEPDIPQGSPTSDQTIPEPVSTDIFWVAGNWSECSTTCGIGAIWRTVACSSSKD
EDCASLKRPEPARTCNLQPCANWKSGGWSKCPDSCGVGGRRHREVQCVDAQSQRPLRPFH
CQNVSSRPVSSLTCPQKPCVTWSISPWGPCSGSCGEGMRERLVYCPAPHRCNTTLRPNST
ETCSLKPCTQWKAEGWEQCSVSCGGGHQQREVRCVSMQDSAVMPNSLCEKISKPEMQKKC
NTQDCKVKTGPVCRKNTMTSRFCDKLKLLGRCSLKSVQKQCCFTC
Download sequence
Identical sequences H3DES8
ENSTNIP00000019021 ENSTNIP00000019021 99883.ENSTNIP00000019021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]