SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019066 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019066
Domain Number 1 Region: 28-142
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.28e-33
Family Frizzled cysteine-rich domain 0.00017
Further Details:      
 
Domain Number 2 Region: 158-261
Classification Level Classification E-value
Superfamily TIMP-like 0.00000706
Family Netrin-like domain (NTR/C345C module) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019066   Gene: ENSTNIG00000015978   Transcript: ENSTNIT00000019294
Sequence length 285
Comment pep:novel chromosome:TETRAODON8:13:9733237:9734360:1 gene:ENSTNIG00000015978 transcript:ENSTNIT00000019294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQTMTLYLTALLALASPLLAFDMGQSTRCVAIPNQMRVCRDVGYSEMRLPNFLGHSSLEG
EVVPRSEDWRPLLQTGCHPQAQAFLCSLIAPVCLDTFIQPCRSLCVAVRDSCAPVLACQG
HPWPEVLDCDRFPAEEDMCLTPHAKFNHFAKDLPKPACQKCPSVEEPSTMKTVLDAFCQY
DFAVTAKLHRHRVPTGEPEFSVEGRVEFLRQGPLLPYDTQHLIQQWLLINVRCASTLVRP
GRSQLYVLTGSVQHDGTIALARLFPWHKRDMHIAVAARKWKHHRC
Download sequence
Identical sequences H3DEX2
ENSTNIP00000019066 ENSTNIP00000019066 99883.ENSTNIP00000019066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]