SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019068 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019068
Domain Number 1 Region: 34-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-41
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 382-534
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000667
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 270-334
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000429
Family VWC domain 0.012
Further Details:      
 
Domain Number 4 Region: 691-763
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.0093
Further Details:      
 
Domain Number 5 Region: 557-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000761
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 523-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000569
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019068
Domain Number - Region: 608-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 335-400
Classification Level Classification E-value
Superfamily FnI-like domain 0.00282
Family VWC domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019068   Gene: ENSTNIG00000015980   Transcript: ENSTNIT00000019296
Sequence length 816
Comment pep:novel chromosome:TETRAODON8:13:9743083:9785108:1 gene:ENSTNIG00000015980 transcript:ENSTNIT00000019296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPRMRRSVLLIRTCILAMFDEVLGFGVDPALRINVFDELTLGEGFDGVTQVQGFHSESRA
FHFQGSSREVVAPVDASEQMIQKLRGKNEFTVLVTLKQDHLNSGVILSIHHSEHSYLELE
SSGQRSVRLHYRTRGQQAHTEVFPYSLADDQWHKVSVAVSASHVILHVDCNRIYERVVEA
PYMDVPEDASFWLGQRNAAHGFFKGVMQDVEILVMPQGYISQCPDLNRTCPTCNDFHGLV
QKIMELQDVLAKTSSKLSRAEEKMNGLEGCYCERTCSVKGVIYREDDGWTDGCRNCTCSN
GTVQCEAISCPPPQCPAGTAPAYMKGACCKECQPVCMFGGKELVEGDQKAVHDSSGKCLL
FECRDRTMHRLVPSEPCPELDCTESEQIVLNDRCCKVCRGHDFCSEGHGCVEHSDCVNLE
AGGCCVCRDGFRPLRDDNAYCEDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRIDD
YSCTEHDECLSGQHNCDDNALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCVT
PNNCVCQQGFTGKRCETDIDECADGFVECDSKSTCVNLPGWYHCECRDGYHDNGLFSTNG
ESCVDINECKTGRNTCANDTVCFNLDGGYDCRCPHGHNCTGDCIHDGKVKHSGQIWVLDS
DRCSVCSCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCLHQNGLLTYGSGDTWVE
NCQQCQCLQGQVDCWPLPCPPVDCEFTVVPEGECCPRCVTDPCQADTIRNDITKTCTDEH
SISRFSGSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences H3DEX4
ENSTNIP00000019068 99883.ENSTNIP00000019068 ENSTNIP00000019068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]