SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019104 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019104
Domain Number 1 Region: 476-602
Classification Level Classification E-value
Superfamily TIMP-like 1.18e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.046
Further Details:      
 
Domain Number 2 Region: 245-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000193
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 3 Region: 314-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 4 Region: 377-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019104
Domain Number - Region: 70-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000659
Family APC10-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019104   Gene: ENSTNIG00000016015   Transcript: ENSTNIT00000019332
Sequence length 603
Comment pep:novel chromosome:TETRAODON8:13:10352209:10355636:1 gene:ENSTNIG00000016015 transcript:ENSTNIT00000019332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFAGSTGPDPEDSCSGRACNPRMGNLALGRVVSTQSVCGSNLSEPFCFYKQAAPPHPRGA
CSPAKCGKCNSAVPGQAHPPSAMSDSSFRQPDTWWQSAEGAKEETLRLDLEAEFLFTHLI
VVFRSPRPAAMVLERSQDRGRTWEPLRYFARDCQRMFGLAEGSACTSKYSGAFPCSRGEV
IYRALPPSNKVDPFGAAGQHQLMVTNLRARLLQRQPCPCQSQQPGAASLPTQHFAIYHFI
AKGGCLCHGHADQCVPARGYTPSLEKTNNMIHGKCVCRHNTAGDHCERCAPLYNDRPWKA
ANGITGTPHECQKCQCSGHARSCHLSRRLWLASGRRSGGVCDHCQHNTEGRHCQDCKRGF
FRDAGLPKSSPDSCKPCSCHPLGSVLSGGSPLCDPGSGACACKPGVGGARCDSCMLGYWG
LHEYGCRPCDCAGDCDPYTGDCIPGSDADALRAAAGSNGSGGVLFRAEELFSALHHSEKC
DCGEANLGGSKLFCAAEYDYVLVVKVMSAHDKGSHAEVEVKVKKVLHQNAGMKIRRGSAT
LYPESWTEQGCTCPILNPGSEYVVAGHQDWKTGRPVVNTKSLVKPWRSSLGRKFLHILRQ
DCG
Download sequence
Identical sequences Q4RSD5
99883.ENSTNIP00000019104 ENSTNIP00000019104 ENSTNIP00000019104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]