SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019119 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019119
Domain Number 1 Region: 7-92,154-268,301-420,521-580,610-633
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.19e-32
Family LacY-like proton/sugar symporter 0.08
Further Details:      
 
Domain Number 2 Region: 438-488
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000596
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019119   Gene: ENSTNIG00000016030   Transcript: ENSTNIT00000019347
Sequence length 679
Comment pep:novel chromosome:TETRAODON8:13:10549541:10553667:-1 gene:ENSTNIG00000016030 transcript:ENSTNIT00000019347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCKEFKMFIAALSFAYFAKALSGSYLKSTITQLERRFDIPSYLIGIIDGSFELGNLLVIA
FVSYFGAKLHRPKIIAVGCVLMSFGTFLIAMPHFLIGRYKIETSVRSLLNSTNNFHPCPE
TSPEPTDRASLQPSRGKVQLCCERGSSVSMWIYIFLGNVLRGIGETPVQPLGISYIDDYA
QTGNAAFYIGCVQTFSVVGPVFGYLLGSLCAKIYVDFEHVDMETLTITPDDARWVGAWWL
GYLITGIVTLTSAVPFWFLPKSLPVPVDKHDFSCSPEQTRFITDSPNLEHKFRQEEPPNL
QQMVQDFVPTLKSLFGNPVYIIYLCVSILQFNSLIGMVTYKPKYIEQHYGQSASTANFLM
GVINIPAVALGMFSGGLVMKKYKLGVMGAAKFAFGTSLLGFVLSLFFLAMGCENSKVAGI
TVSYSGVEGLSYQEPSLFSDCNSGCLCSRREWDPVCGENGITYVSPCLAGCVSSTGSGRN
TVFDSCRCVALVNGQPGNLTAALGRCPGRDSCDRIFPYFMALSVLSSFIISLGGTPGFMV
LVRCMKPELKSLAIGIYTLATRTLAGIPAPIYFGAIIDTTCLKWSYNICDGRGACRIYNT
SAYSRILYLGLTLGLRTLSFFLCISGFAFLKRHIRREEKSPLSDGSTELESSRKEEGVFA
LREQCLPASDARRDRETCL
Download sequence
Identical sequences H3DF25
ENSTNIP00000019119 99883.ENSTNIP00000019119 ENSTNIP00000019119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]