SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019147 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019147
Domain Number 1 Region: 42-521
Classification Level Classification E-value
Superfamily Sema domain 5.49e-113
Family Sema domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 1094-1356
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-77
Family Protein kinases, catalytic subunit 0.000000001
Further Details:      
 
Domain Number 3 Region: 663-750
Classification Level Classification E-value
Superfamily E set domains 7e-16
Family Other IPT/TIG domains 0.047
Further Details:      
 
Domain Number 4 Region: 523-570
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 566-650
Classification Level Classification E-value
Superfamily E set domains 0.00000000242
Family Other IPT/TIG domains 0.046
Further Details:      
 
Domain Number 6 Region: 749-841
Classification Level Classification E-value
Superfamily E set domains 0.000000117
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019147   Gene: ENSTNIG00000016058   Transcript: ENSTNIT00000019375
Sequence length 1420
Comment pep:novel chromosome:TETRAODON8:13:11078561:11115524:1 gene:ENSTNIG00000016058 transcript:ENSTNIT00000019375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCCLPAVPLLLLLLWALSASAEGHCDKSPETNKLNLSVSYELPTFTADSPIQNMVTLD
GIIYVGAVNRIYALAPDLTKLSEYHTGPLLANQTCGQKFANTSFGGGRKDNVNVALVLEN
IYDKGLFSCGSADNGVCRRHVLEDDVSQKSVDEQVYCFTDLKQDKGQPRDSDVVVSPSGS
QVLNVESNMIMFFVGNSEIPGLGNGIGSATHPHTMSLRKMKTSQNGFTFLSSQSYMDLIP
PLRGSYYLRYVYSFHSGPFTYFLTVQQVSKDSQAYHTRIVRMCSFDHDIRRYVEMPLECI
STDKRRRRSTEDVKVFNILQAANVTKVGSDVELQRQLKVEEDDDVLFAAFARGKPNSPEP
TPNSAICIMSLKHINDMFKMYMKKCNTVDLYHFTGSDTKSCYNVSSSNDCDPHEGIHEGK
EGKYRLQVTQFVQRLEYWHKELTNTLVTSINVVPVHGRAVAYLGTADGRHIQVVFSRSLR
PHVNIRLDSRPVSAGVVLPGQNLSEGALLLATGNKITKVPLIGPGCDQLTTCTSCLLSSR
VTECGWCDGRCTRANQCPSSIWTQEYCTPVITKVFPTSGPIRGSTTVTICGLNFGFVKTE
SFKVPLVTVEVAGAHCKLLRQDYINRWTEIQCSPMSAGNFTPSGHTVKVTSGHMVAKMDG
FTFVDPVISEIFPTFGPKSGSTMLTIRGASLDTGNKLEVTVGKAACNIQSLSPTMLTCKT
SPYAVPCKQPVKLTVDSVERQAPLLFTYNRDPIISSIQPSRSFVSGGCTVVAHGLFLQSG
LQPQMILTTGQDAEVFHVSCVYGENGTSIHCTTPSLAKLALQPPVVTKVAFVLDGYMTEQ
KDLIYVEDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLTLVGNTLE
CTIPTELQTTTSKELQVEWRQADSVIHLGNLMLAQEQDYTGLVVGSVCVSLLLLLLGSLL
MWRRNKNIDDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTNLLEDQGTDR
PETCRAGPPIYGSNGELLSPRLVTLGSGMGLGMEGELVSPLLMAPVHIDPSCLHPDLLTE
VQHVVIAREQLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEEVSQFL
KEGIIMKDFSHPNVLSLLGICLPPEGSPLMVLPYMKHGDLRNFIRDEAHNPTVKDLMGFG
LQVARGMEYLASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNKSGVKL
PVKWMALESLQTHKFTTKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGRRLLQP
EFCPDALYTVMIECWHPNPERRHSYSELVSSTTYYYSYCGVHYLLTTTYVHIVKMNPYPS
LLVSTHLTPSSSSLSSDPFTSTSLPTQSHLLSRVERQCCT
Download sequence
Identical sequences H3DF54
99883.ENSTNIP00000019148 ENSTNIP00000019148 ENSTNIP00000019147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]