SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019179 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019179
Domain Number 1 Region: 224-390,684-902,956-998
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-108
Family Ras GEF 0.00013
Further Details:      
 
Domain Number 2 Region: 371-457
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 3 Region: 102-226
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-17
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 594-673
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000749
Family Ras-binding domain, RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019179   Gene: ENSTNIG00000016088   Transcript: ENSTNIT00000019407
Sequence length 1423
Comment pep:novel chromosome:TETRAODON8:7:8979284:9001877:-1 gene:ENSTNIG00000016088 transcript:ENSTNIT00000019407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQSESVQLPGDLNKMHLTDHAHQQVMHVPPSQSGCSIASDSGSSSLSDIYQATESELGD
VDLSGLPEAAVDSEEDEEEDEDLERASDTLLGRDLVRECLEKDPVDRNDDDIEQLLEFMH
QLPAFANMTMSVRRELCSVMVFEVVEQAGTIILHNKQELDLWYVILNGAVEISYPDSRME
TLCMGNSFGISPSLDKQYMHGEVRTKGDDCQFVCIAQEDYWRILNHVEKNTHKVEEEGEI
VMVKEHRELDRSGTRKGHIVIKGTPERLIMHLVEEPSVVDPTYIEDFLLTYRTFLSNPME
VGKKLLEWFQVDTLRDTVTRIVLLWVNNHFNDFEGNPAMTRFLEEFEKLLETTKMKGHLR
LLNIACAAKAKLRQITLQKASRESPLYFSVQGGSERGFGIFVDSVEEGSKAAETGLKRGD
QIMEVNGQNFENIPITKAVDILRNNTHLSLTIKTNIFVFKELLSRVLHEKKNGGPHIPKI
QEKKGNRFSIPDLPGDMECPLTQEPRKCSNTVSGVSFLSPFNSNPPLTPIPALLCSDGGM
VQSQDDSIVGTKQCRHSVAIMPIPGNLSSSSPDLLQPATSVLDFSNPADIPDQVIRVFKA
DQQSCYIIISKDTTAKDVVAHSVNEFGLIAAPETYSLCEVSVSPEGFIKQRRLPDQLSKL
ADRIQLNGRYYLKNNMETETLCSDEDAQDLLRESQISLLQLSTMEVAAQLSMRDFELFRN
IESTEYLDDLFKLDTSIGSRNLKQFEEVINQETFWVASEILKEPNTLKRMKTIKHFIKIA
LHCRECKNFNSMFAIISGLNLAPVARLRSSWEKLPSKYEKLFGDLQDVFDPSRNMAKYRN
VLSSQSMQPPIIPLFPVVKKDLTFLHEGNDSTVDGLVNFEKLRMIAKEIRHIVRLTSANM
DPALMFRQRKSLPPSCMSLSQGSTNSNMLDVQGGAHKKRVRRSSLLNAKKLYEDAQMARK
VKQYLSNLTVETDEEKFQFMSLQCEPSYSTLSKYLSERRSTKSDMSPVSLRSALPSAKTQ
NRVSQVLQVQVPLNPLRKKSNAKDTGPPNSNSPQVVKKPPVSSSEEWNTKRPSDDTVSTV
SSLHSSPTVSPQGSPRKGYTFLPAGKADNLSDSSHSEISSRSSICSVDSMPAPGPDERCS
GTNRTAAGVATTTPAMVTDSTAHTHFNADYSQPSTSNSSPSARGYVPRGSAVTSSASTEE
LTPDHTSLDSVADSGRGSWTSCSSNSHDSFQSLPSSSCRPWDHGIHGHPLAFAHLGGFKH
TQLAGPIAEMEAATQAWLKEDGAAKQHSRNSSSDLSNQSRQSWASSSSLSDTYEGNYGTI
KRRNASEHPSSPTNEEGGQSTDHVYKTVTSSTEKGLIVYCVTSPSKDERYRAPPPTPPGY
QGLALGDLGLADGSASGPGGLGPRPPHLRPPDYSVALQRSKLL
Download sequence
Identical sequences H3DF85
99883.ENSTNIP00000019179 ENSTNIP00000019179 ENSTNIP00000019179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]